PIP4K2C (phosphatidylinositol-5-phosphate 4-kinase type 2 gamma)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79837
• Gene name: Phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
• Gene symbol: PIP4K2C
• Synonyms (NCBI Gene): PIP5K2C
• Chromosome: 12
• Chromosome location: 12q13.3

miRNA Show/Hide all (329)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016341	hsa-miR-193b-3p	Proteomics	21512034
MIRT045985	hsa-miR-125b-5p	CLASH	23622248
MIRT036860	hsa-miR-877-3p	CLASH	23622248
MIRT066182	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT066166	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT066180	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT555602	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT066175	hsa-miR-3174	PAR-CLIP	21572407
MIRT066165	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT066177	hsa-miR-3617-3p	PAR-CLIP	21572407
MIRT066169	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT135785	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT066171	hsa-miR-921	PAR-CLIP	21572407
MIRT066168	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT555601	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT066181	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT066167	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT449859	hsa-miR-3137	PAR-CLIP	22100165
MIRT449858	hsa-miR-20b-3p	PAR-CLIP	22100165
MIRT449857	hsa-miR-574-5p	PAR-CLIP	22100165
MIRT449856	hsa-miR-3659	PAR-CLIP	22100165
MIRT449855	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449854	hsa-miR-1238-5p	PAR-CLIP	22100165
MIRT449853	hsa-miR-4758-5p	PAR-CLIP	22100165
MIRT449852	hsa-miR-4658	PAR-CLIP	22100165
MIRT449851	hsa-miR-6790-5p	PAR-CLIP	22100165
MIRT135718	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT135706	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT135718	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT135705	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT135724	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT135707	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT135733	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT135706	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT135785	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT066169	hsa-miR-545-3p	PAR-CLIP	27292025
MIRT066182	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT066166	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT066180	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT555602	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT066175	hsa-miR-3174	PAR-CLIP	21572407
MIRT066165	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT066177	hsa-miR-3617-3p	PAR-CLIP	21572407
MIRT066169	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT135785	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT066171	hsa-miR-921	PAR-CLIP	21572407
MIRT066168	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT555601	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT066181	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT066167	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT449859	hsa-miR-3137	PAR-CLIP	22100165
MIRT449858	hsa-miR-20b-3p	PAR-CLIP	22100165
MIRT449857	hsa-miR-574-5p	PAR-CLIP	22100165
MIRT449856	hsa-miR-3659	PAR-CLIP	22100165
MIRT449855	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449854	hsa-miR-1238-5p	PAR-CLIP	22100165
MIRT449853	hsa-miR-4758-5p	PAR-CLIP	22100165
MIRT449852	hsa-miR-4658	PAR-CLIP	22100165
MIRT449851	hsa-miR-6790-5p	PAR-CLIP	22100165
MIRT1235734	hsa-miR-106a	CLIP-seq
MIRT1235735	hsa-miR-106b	CLIP-seq
MIRT1235736	hsa-miR-1273f	CLIP-seq
MIRT1235737	hsa-miR-17	CLIP-seq
MIRT1235738	hsa-miR-20a	CLIP-seq
MIRT1235739	hsa-miR-20b	CLIP-seq
MIRT1235740	hsa-miR-3127-3p	CLIP-seq
MIRT1235741	hsa-miR-3153	CLIP-seq
MIRT1235742	hsa-miR-324-5p	CLIP-seq
MIRT1235743	hsa-miR-340	CLIP-seq
MIRT1235744	hsa-miR-4640-3p	CLIP-seq
MIRT1235745	hsa-miR-4787-5p	CLIP-seq
MIRT1235746	hsa-miR-519a	CLIP-seq
MIRT1235747	hsa-miR-519b-3p	CLIP-seq
MIRT1235748	hsa-miR-519c-3p	CLIP-seq
MIRT1235749	hsa-miR-519d	CLIP-seq
MIRT1235750	hsa-miR-520a-5p	CLIP-seq
MIRT1235751	hsa-miR-520g	CLIP-seq
MIRT1235752	hsa-miR-520h	CLIP-seq
MIRT1235753	hsa-miR-525-5p	CLIP-seq
MIRT1235754	hsa-miR-545	CLIP-seq
MIRT1235755	hsa-miR-548p	CLIP-seq
MIRT1235756	hsa-miR-561	CLIP-seq
MIRT1235757	hsa-miR-625	CLIP-seq
MIRT1235758	hsa-miR-93	CLIP-seq
MIRT1235759	hsa-miR-330-3p	CLIP-seq
MIRT1235760	hsa-miR-4330	CLIP-seq
MIRT1235761	hsa-miR-4797-5p	CLIP-seq
MIRT1235762	hsa-miR-646	CLIP-seq
MIRT1235763	hsa-miR-137	CLIP-seq
MIRT1235764	hsa-miR-185	CLIP-seq
MIRT1235765	hsa-miR-200b	CLIP-seq
MIRT1235766	hsa-miR-200c	CLIP-seq
MIRT1235767	hsa-miR-25	CLIP-seq
MIRT1235768	hsa-miR-3065-5p	CLIP-seq
MIRT1235769	hsa-miR-3143	CLIP-seq
MIRT1235770	hsa-miR-3150a-3p	CLIP-seq
MIRT1235741	hsa-miR-3153	CLIP-seq
MIRT1235771	hsa-miR-3175	CLIP-seq
MIRT1235772	hsa-miR-32	CLIP-seq
MIRT1235773	hsa-miR-33a	CLIP-seq
MIRT1235774	hsa-miR-33b	CLIP-seq
MIRT1235775	hsa-miR-3614-5p	CLIP-seq
MIRT1235776	hsa-miR-363	CLIP-seq
MIRT1235777	hsa-miR-367	CLIP-seq
MIRT1235778	hsa-miR-3689a-3p	CLIP-seq
MIRT1235779	hsa-miR-3689c	CLIP-seq
MIRT1235780	hsa-miR-429	CLIP-seq
MIRT1235781	hsa-miR-4306	CLIP-seq
MIRT1235782	hsa-miR-4644	CLIP-seq
MIRT1235783	hsa-miR-4771	CLIP-seq
MIRT1235745	hsa-miR-4787-5p	CLIP-seq
MIRT1235784	hsa-miR-499a-5p	CLIP-seq
MIRT1235785	hsa-miR-505	CLIP-seq
MIRT1235786	hsa-miR-543	CLIP-seq
MIRT1235787	hsa-miR-576-5p	CLIP-seq
MIRT1235757	hsa-miR-625	CLIP-seq
MIRT1235788	hsa-miR-92a	CLIP-seq
MIRT1235789	hsa-miR-92b	CLIP-seq
MIRT1235790	hsa-miR-939	CLIP-seq
MIRT2069391	hsa-miR-3179	CLIP-seq
MIRT1235759	hsa-miR-330-3p	CLIP-seq
MIRT1235743	hsa-miR-340	CLIP-seq
MIRT2069392	hsa-miR-3617	CLIP-seq
MIRT2069393	hsa-miR-3675-5p	CLIP-seq
MIRT2069394	hsa-miR-641	CLIP-seq
MIRT2069395	hsa-miR-3140-5p	CLIP-seq
MIRT1235734	hsa-miR-106a	CLIP-seq
MIRT1235735	hsa-miR-106b	CLIP-seq
MIRT2296743	hsa-miR-1184	CLIP-seq
MIRT2296744	hsa-miR-1224-3p	CLIP-seq
MIRT2296745	hsa-miR-1244	CLIP-seq
MIRT2296746	hsa-miR-1260	CLIP-seq
MIRT2296747	hsa-miR-1260b	CLIP-seq
MIRT2296748	hsa-miR-1273e	CLIP-seq
MIRT2296749	hsa-miR-1294	CLIP-seq
MIRT1235763	hsa-miR-137	CLIP-seq
MIRT2296750	hsa-miR-138	CLIP-seq
MIRT2296751	hsa-miR-140-3p	CLIP-seq
MIRT2296752	hsa-miR-145	CLIP-seq
MIRT2296753	hsa-miR-15a	CLIP-seq
MIRT2296754	hsa-miR-15b	CLIP-seq
MIRT2296755	hsa-miR-16	CLIP-seq
MIRT1235737	hsa-miR-17	CLIP-seq
MIRT1235764	hsa-miR-185	CLIP-seq
MIRT2296756	hsa-miR-1915	CLIP-seq
MIRT2296757	hsa-miR-195	CLIP-seq
MIRT2296758	hsa-miR-1972	CLIP-seq
MIRT1235765	hsa-miR-200b	CLIP-seq
MIRT1235766	hsa-miR-200c	CLIP-seq
MIRT1235738	hsa-miR-20a	CLIP-seq
MIRT1235739	hsa-miR-20b	CLIP-seq
MIRT2296759	hsa-miR-2278	CLIP-seq
MIRT1235767	hsa-miR-25	CLIP-seq
MIRT2296760	hsa-miR-2682	CLIP-seq
MIRT1235768	hsa-miR-3065-5p	CLIP-seq
MIRT2069395	hsa-miR-3140-5p	CLIP-seq
MIRT1235769	hsa-miR-3143	CLIP-seq
MIRT1235772	hsa-miR-32	CLIP-seq
MIRT1235742	hsa-miR-324-5p	CLIP-seq
MIRT1235775	hsa-miR-3614-5p	CLIP-seq
MIRT2069392	hsa-miR-3617	CLIP-seq
MIRT1235776	hsa-miR-363	CLIP-seq
MIRT1235777	hsa-miR-367	CLIP-seq
MIRT1235778	hsa-miR-3689a-3p	CLIP-seq
MIRT1235779	hsa-miR-3689c	CLIP-seq
MIRT2296761	hsa-miR-377	CLIP-seq
MIRT2296762	hsa-miR-3919	CLIP-seq
MIRT2296763	hsa-miR-3925-5p	CLIP-seq
MIRT2296764	hsa-miR-3942-5p	CLIP-seq
MIRT2296765	hsa-miR-424	CLIP-seq
MIRT1235780	hsa-miR-429	CLIP-seq
MIRT2296766	hsa-miR-4293	CLIP-seq
MIRT2296767	hsa-miR-4299	CLIP-seq
MIRT1235781	hsa-miR-4306	CLIP-seq
MIRT2296768	hsa-miR-4316	CLIP-seq
MIRT2296769	hsa-miR-4456	CLIP-seq
MIRT2296770	hsa-miR-449c	CLIP-seq
MIRT2296771	hsa-miR-4514	CLIP-seq
MIRT1235782	hsa-miR-4644	CLIP-seq
MIRT2296772	hsa-miR-4645-5p	CLIP-seq
MIRT2296773	hsa-miR-4651	CLIP-seq
MIRT2296774	hsa-miR-4673	CLIP-seq
MIRT2296775	hsa-miR-4680-3p	CLIP-seq
MIRT2296776	hsa-miR-4692	CLIP-seq
MIRT2296777	hsa-miR-4703-3p	CLIP-seq
MIRT2296778	hsa-miR-4703-5p	CLIP-seq
MIRT2296779	hsa-miR-4709-3p	CLIP-seq
MIRT2296780	hsa-miR-4726-3p	CLIP-seq
MIRT2296781	hsa-miR-4756-3p	CLIP-seq
MIRT2296782	hsa-miR-4768-3p	CLIP-seq
MIRT1235783	hsa-miR-4771	CLIP-seq
MIRT1235761	hsa-miR-4797-5p	CLIP-seq
MIRT2296783	hsa-miR-497	CLIP-seq
MIRT1235784	hsa-miR-499a-5p	CLIP-seq
MIRT1235785	hsa-miR-505	CLIP-seq
MIRT1235746	hsa-miR-519a	CLIP-seq
MIRT1235747	hsa-miR-519b-3p	CLIP-seq
MIRT1235748	hsa-miR-519c-3p	CLIP-seq
MIRT1235749	hsa-miR-519d	CLIP-seq
MIRT1235750	hsa-miR-520a-5p	CLIP-seq
MIRT1235751	hsa-miR-520g	CLIP-seq
MIRT1235752	hsa-miR-520h	CLIP-seq
MIRT1235753	hsa-miR-525-5p	CLIP-seq
MIRT1235786	hsa-miR-543	CLIP-seq
MIRT1235754	hsa-miR-545	CLIP-seq
MIRT1235755	hsa-miR-548p	CLIP-seq
MIRT2296784	hsa-miR-548q	CLIP-seq
MIRT1235787	hsa-miR-576-5p	CLIP-seq
MIRT2296785	hsa-miR-589	CLIP-seq
MIRT2296786	hsa-miR-596	CLIP-seq
MIRT2296787	hsa-miR-597	CLIP-seq
MIRT2296788	hsa-miR-608	CLIP-seq
MIRT2296789	hsa-miR-628-5p	CLIP-seq
MIRT2069394	hsa-miR-641	CLIP-seq
MIRT2296790	hsa-miR-654-3p	CLIP-seq
MIRT2296791	hsa-miR-665	CLIP-seq
MIRT1235788	hsa-miR-92a	CLIP-seq
MIRT1235789	hsa-miR-92b	CLIP-seq
MIRT1235758	hsa-miR-93	CLIP-seq
MIRT2456526	hsa-miR-298	CLIP-seq
MIRT1235771	hsa-miR-3175	CLIP-seq
MIRT2069391	hsa-miR-3179	CLIP-seq
MIRT2456527	hsa-miR-4468	CLIP-seq
MIRT2296744	hsa-miR-1224-3p	CLIP-seq
MIRT2594182	hsa-miR-1225-5p	CLIP-seq
MIRT2296746	hsa-miR-1260	CLIP-seq
MIRT2296747	hsa-miR-1260b	CLIP-seq
MIRT2594183	hsa-miR-1280	CLIP-seq
MIRT2296749	hsa-miR-1294	CLIP-seq
MIRT2594184	hsa-miR-135a	CLIP-seq
MIRT2594185	hsa-miR-135b	CLIP-seq
MIRT1235764	hsa-miR-185	CLIP-seq
MIRT2594186	hsa-miR-1910	CLIP-seq
MIRT2594187	hsa-miR-197	CLIP-seq
MIRT2456526	hsa-miR-298	CLIP-seq
MIRT2594188	hsa-miR-3130-3p	CLIP-seq
MIRT1235771	hsa-miR-3175	CLIP-seq
MIRT2069391	hsa-miR-3179	CLIP-seq
MIRT2594189	hsa-miR-3183	CLIP-seq
MIRT2594190	hsa-miR-3187-3p	CLIP-seq
MIRT2594191	hsa-miR-326	CLIP-seq
MIRT1235759	hsa-miR-330-3p	CLIP-seq
MIRT2594192	hsa-miR-330-5p	CLIP-seq
MIRT2069393	hsa-miR-3675-5p	CLIP-seq
MIRT2594193	hsa-miR-3909	CLIP-seq
MIRT2594194	hsa-miR-4283	CLIP-seq
MIRT2594195	hsa-miR-4287	CLIP-seq
MIRT2594196	hsa-miR-4300	CLIP-seq
MIRT1235781	hsa-miR-4306	CLIP-seq
MIRT2296768	hsa-miR-4316	CLIP-seq
MIRT2594197	hsa-miR-4419a	CLIP-seq
MIRT2456527	hsa-miR-4468	CLIP-seq
MIRT2594198	hsa-miR-4469	CLIP-seq
MIRT2594199	hsa-miR-4488	CLIP-seq
MIRT2594200	hsa-miR-4493	CLIP-seq
MIRT2594201	hsa-miR-4510	CLIP-seq
MIRT2594202	hsa-miR-4529-5p	CLIP-seq
MIRT2594203	hsa-miR-455-3p	CLIP-seq
MIRT2594204	hsa-miR-4639-3p	CLIP-seq
MIRT1235782	hsa-miR-4644	CLIP-seq
MIRT2296773	hsa-miR-4651	CLIP-seq
MIRT2594205	hsa-miR-4667-5p	CLIP-seq
MIRT2594206	hsa-miR-4677-3p	CLIP-seq
MIRT2594207	hsa-miR-4679	CLIP-seq
MIRT2594208	hsa-miR-4684-5p	CLIP-seq
MIRT2594209	hsa-miR-4685-3p	CLIP-seq
MIRT2594210	hsa-miR-4693-3p	CLIP-seq
MIRT2594211	hsa-miR-4697-5p	CLIP-seq
MIRT2594212	hsa-miR-4699-5p	CLIP-seq
MIRT2594213	hsa-miR-4700-5p	CLIP-seq
MIRT2594214	hsa-miR-4711-5p	CLIP-seq
MIRT2594215	hsa-miR-4713-5p	CLIP-seq
MIRT2594216	hsa-miR-4723-3p	CLIP-seq
MIRT2594217	hsa-miR-4753-5p	CLIP-seq
MIRT2594218	hsa-miR-4755-3p	CLIP-seq
MIRT2594219	hsa-miR-4757-5p	CLIP-seq
MIRT2594220	hsa-miR-4763-5p	CLIP-seq
MIRT1235761	hsa-miR-4797-5p	CLIP-seq
MIRT2594221	hsa-miR-578	CLIP-seq
MIRT2594222	hsa-miR-581	CLIP-seq
MIRT2594223	hsa-miR-582-3p	CLIP-seq
MIRT2296788	hsa-miR-608	CLIP-seq
MIRT2296789	hsa-miR-628-5p	CLIP-seq
MIRT2594224	hsa-miR-637	CLIP-seq
MIRT1235762	hsa-miR-646	CLIP-seq
MIRT2594225	hsa-miR-920	CLIP-seq
MIRT2296744	hsa-miR-1224-3p	CLIP-seq
MIRT2296744	hsa-miR-1224-3p	CLIP-seq
MIRT2594182	hsa-miR-1225-5p	CLIP-seq
MIRT2296746	hsa-miR-1260	CLIP-seq
MIRT2296747	hsa-miR-1260b	CLIP-seq
MIRT2594183	hsa-miR-1280	CLIP-seq
MIRT2296749	hsa-miR-1294	CLIP-seq
MIRT2594186	hsa-miR-1910	CLIP-seq
MIRT2456526	hsa-miR-298	CLIP-seq
MIRT2594188	hsa-miR-3130-3p	CLIP-seq
MIRT1235771	hsa-miR-3175	CLIP-seq
MIRT2069391	hsa-miR-3179	CLIP-seq
MIRT2594190	hsa-miR-3187-3p	CLIP-seq
MIRT1235759	hsa-miR-330-3p	CLIP-seq
MIRT2069393	hsa-miR-3675-5p	CLIP-seq
MIRT2594193	hsa-miR-3909	CLIP-seq
MIRT2594194	hsa-miR-4283	CLIP-seq
MIRT2594195	hsa-miR-4287	CLIP-seq
MIRT2594196	hsa-miR-4300	CLIP-seq
MIRT2296768	hsa-miR-4316	CLIP-seq
MIRT1235760	hsa-miR-4330	CLIP-seq
MIRT2594197	hsa-miR-4419a	CLIP-seq
MIRT2456527	hsa-miR-4468	CLIP-seq
MIRT2594198	hsa-miR-4469	CLIP-seq
MIRT2594199	hsa-miR-4488	CLIP-seq
MIRT2594201	hsa-miR-4510	CLIP-seq
MIRT2594202	hsa-miR-4529-5p	CLIP-seq
MIRT2594203	hsa-miR-455-3p	CLIP-seq
MIRT2594204	hsa-miR-4639-3p	CLIP-seq
MIRT2594206	hsa-miR-4677-3p	CLIP-seq
MIRT2594207	hsa-miR-4679	CLIP-seq
MIRT2594208	hsa-miR-4684-5p	CLIP-seq
MIRT2594209	hsa-miR-4685-3p	CLIP-seq
MIRT2594211	hsa-miR-4697-5p	CLIP-seq
MIRT2594215	hsa-miR-4713-5p	CLIP-seq
MIRT2594218	hsa-miR-4755-3p	CLIP-seq
MIRT2594219	hsa-miR-4757-5p	CLIP-seq
MIRT2594220	hsa-miR-4763-5p	CLIP-seq
MIRT1235761	hsa-miR-4797-5p	CLIP-seq
MIRT2687936	hsa-miR-526b	CLIP-seq
MIRT2594223	hsa-miR-582-3p	CLIP-seq
MIRT2296789	hsa-miR-628-5p	CLIP-seq
MIRT2594225	hsa-miR-920	CLIP-seq

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	31091439
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005776	Component	Autophagosome	IMP	25578879
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0010506	Process	Regulation of autophagy	IMP	25578879
GO:0016301	Function	Kinase activity	IEA
GO:0016308	Function	1-phosphatidylinositol-4-phosphate 5-kinase activity	IDA	26774281
GO:0016308	Function	1-phosphatidylinositol-4-phosphate 5-kinase activity	IEA
GO:0016309	Function	1-phosphatidylinositol-5-phosphate 4-kinase activity	IBA
GO:0016309	Function	1-phosphatidylinositol-5-phosphate 4-kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	18255255
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	30718367
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	31091439
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IBA
GO:0052742	Function	Phosphatidylinositol kinase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454, 19056867
GO:1902635	Process	1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process	IDA	26774281
GO:1902635	Process	1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process	IEA
GO:2000786	Process	Positive regulation of autophagosome assembly	IEA
GO:2000786	Process	Positive regulation of autophagosome assembly	IMP	25578879

Other IDs

• MIM: 617104
• HGNC: 23786
• e!Ensembl: ENSG00000166908

Protein

• UniProt ID: Q8TBX8
• Protein name: Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma (EC 2.7.1.149) (Phosphatidylinositol 5-phosphate 4-kinase type II gamma) (PI(5)P 4-kinase type II gamma) (PIP4KII-gamma)
• Protein function: Phosphatidylinositol 5-phosphate 4-kinase with low enzymatic activity. May be a GTP sensor, has higher GTP-dependent kinase activity than ATP-dependent kinase activity. PIP4Ks negatively regulate insulin signaling through a catalytic-independent
• PDB: 2GK9 , 7QIE , 7QPN , 8BQ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01504	PIP5K	128 → 419	Phosphatidylinositol-4-phosphate 5-Kinase	Family

• Sequence:

  MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
  ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
  DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
  LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
  KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
  PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
  GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
  A

• Sequence length: 421

Pathways

KEGG Pathway	Reactome Pathway
Inositol phosphate metabolism	Synthesis of PIPs at the plasma membrane
Metabolic pathways	PI5P Regulates TP53 Acetylation
Phosphatidylinositol signaling system	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Regulation of actin cytoskeleton	Synthesis of PIPs in the nucleus

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	34312224	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16094259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29851245, 30104711		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26070530	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34006268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19110536		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	31109595		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38069220	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31109595		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29851245, 30104711		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31109595, 31804920		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30321068		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16094259, 16801950, 17555944, 18545987, 19644675, 25548108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16094259, 16801950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PIP4K2A 7 shared pathwaysInositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling, Synthesis of PIPs at the plasma membrane, PI5P Regulates TP53 Acetylation, Synthesis of PIPs in the nucleus Related via 7 shared pathways including Inositol phosphate metabolism, Phosphatidylinositol signaling system. PIP4K2B 7 shared pathwaysInositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling, Synthesis of PIPs at the plasma membrane, PI5P Regulates TP53 Acetylation, Synthesis of PIPs in the nucleus Related via 7 shared pathways including Inositol phosphate metabolism, Phosphatidylinositol signaling system. MTMR8 3 shared pathwaysInositol phosphate metabolism, Phosphatidylinositol signaling system, Synthesis of PIPs at the plasma membrane Related via 3 shared pathways including Inositol phosphate metabolism, Phosphatidylinositol signaling system. MTMR1 3 shared pathwaysInositol phosphate metabolism, Phosphatidylinositol signaling system, Synthesis of PIPs at the plasma membrane Related via 3 shared pathways including Inositol phosphate metabolism, Phosphatidylinositol signaling system. MTMR6 3 shared pathwaysInositol phosphate metabolism, Phosphatidylinositol signaling system, Synthesis of PIPs at the plasma membrane Related via 3 shared pathways including Inositol phosphate metabolism, Phosphatidylinositol signaling system.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PIP4K2A	0	[]	7	["Inositol phosphate metabolism","Phosphatidylinositol signaling system","Regulation of actin cytoskeleton","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling","Synthesis of PIPs at the plasma membrane","PI5P Regulates TP53 Acetylation","Synthesis of PIPs in the nucleus"]	0	[]
PIP4K2B	0	[]	7	["Inositol phosphate metabolism","Phosphatidylinositol signaling system","Regulation of actin cytoskeleton","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling","Synthesis of PIPs at the plasma membrane","PI5P Regulates TP53 Acetylation","Synthesis of PIPs in the nucleus"]	0	[]
MTMR8	0	[]	3	["Inositol phosphate metabolism","Phosphatidylinositol signaling system","Synthesis of PIPs at the plasma membrane"]	0	[]
MTMR1	0	[]	3	["Inositol phosphate metabolism","Phosphatidylinositol signaling system","Synthesis of PIPs at the plasma membrane"]	0	[]
MTMR6	0	[]	3	["Inositol phosphate metabolism","Phosphatidylinositol signaling system","Synthesis of PIPs at the plasma membrane"]	0	[]

Diseases Linked via Similar Genes

Breast cancer Linked via 2 of 5 related genesPIP4K2A, PIP4K2B Alzheimer disease Linked via 1 of 5 related genesPIP4K2A B-cell acute lymphoblastic leukemia Linked via 1 of 5 related genesPIP4K2A B-lymphoblastic leukemia/lymphoma Linked via 1 of 5 related genesPIP4K2A Lymphoblastic leukemia Linked via 1 of 5 related genesPIP4K2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast cancer	2	["PIP4K2A","PIP4K2B"]
Alzheimer disease	1	["PIP4K2A"]
B-cell acute lymphoblastic leukemia	1	["PIP4K2A"]
B-lymphoblastic leukemia/lymphoma	1	["PIP4K2A"]
Lymphoblastic leukemia	1	["PIP4K2A"]