Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	29990
Gene name	Paired immunoglobin like type 2 receptor beta
Gene symbol	PILRB
Synonyms (NCBI Gene)	FDFACT1FDFACT2
Chromosome	7
Chromosome location	7q22.1
Summary	The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved in the regulation of many aspects of the immune system. The paired immunoglobulin-like receptor genes are located in a tandem hea

31 Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720913	hsa-miR-4716-5p	HITS-CLIP	19536157
MIRT720912	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT720911	hsa-miR-3907	HITS-CLIP	19536157
MIRT720910	hsa-miR-192-3p	HITS-CLIP	19536157
MIRT720913	hsa-miR-4716-5p	HITS-CLIP	19536157
MIRT720912	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT720911	hsa-miR-3907	HITS-CLIP	19536157
MIRT720910	hsa-miR-192-3p	HITS-CLIP	19536157
MIRT2069223	hsa-miR-4680-5p	CLIP-seq
MIRT2296310	hsa-miR-369-3p	CLIP-seq
MIRT2296311	hsa-miR-374a	CLIP-seq
MIRT2296312	hsa-miR-374b	CLIP-seq
MIRT2392540	hsa-miR-1237	CLIP-seq
MIRT2392541	hsa-miR-1248	CLIP-seq
MIRT2392542	hsa-miR-4312	CLIP-seq
MIRT2392543	hsa-miR-4727-5p	CLIP-seq
MIRT2392544	hsa-miR-711	CLIP-seq
MIRT2594023	hsa-miR-188-5p	CLIP-seq
MIRT2594024	hsa-miR-342-3p	CLIP-seq
MIRT2594025	hsa-miR-3621	CLIP-seq
MIRT2594026	hsa-miR-374c	CLIP-seq
MIRT2594027	hsa-miR-4457	CLIP-seq
MIRT2594028	hsa-miR-4489	CLIP-seq
MIRT2594029	hsa-miR-4508	CLIP-seq
MIRT2594030	hsa-miR-4643	CLIP-seq
MIRT2594031	hsa-miR-466	CLIP-seq
MIRT2594032	hsa-miR-4789-3p	CLIP-seq
MIRT2594033	hsa-miR-499-3p	CLIP-seq
MIRT2594034	hsa-miR-499a-3p	CLIP-seq
MIRT2594035	hsa-miR-513b	CLIP-seq
MIRT2594036	hsa-miR-655	CLIP-seq

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10660620
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10660620
GO:0005886	Component	Plasma membrane	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	10660620
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	NAS	10660620
GO:0016020	Component	Membrane	IEA
GO:0042288	Function	MHC class I protein binding	IBA

MIM	HGNC	e!Ensembl
605342	18297	ENSG00000121716

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9UKJ0
Protein name	Paired immunoglobulin-like type 2 receptor beta (Activating receptor PILR-beta) (Cell surface receptor FDFACT)
Protein function	Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing
PDB	4NFC , 4NFD
Family and domains
Sequence	MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE LAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQ SVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSE SWHLSLDTAIRVALAVAVLKTVILGLLCLLLLWWRRRKGSRAPSSDF
Sequence length	227
Interactions	View interactions

KEGG Pathway	Reactome Pathway
Virion - Herpesvirus	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Herpes simplex virus 1 infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Alzheimer Disease	Alzheimer disease	Pubtator	26919393, 38527854, 40050982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy body disease	Pubtator	38527854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34534445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37033267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30619483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37143720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35711565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PILRB (paired immunoglobin like type 2 receptor beta)

Bookmark This Gene