PDGFD (platelet derived growth factor D)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80310
• Gene name: Platelet derived growth factor D
• Gene symbol: PDGFD
• Synonyms (NCBI Gene): IEGF, MSTP036, SCDGF-B, SCDGFB
• Chromosome: 11
• Chromosome location: 11q22.3
• Summary: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f

miRNA Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030746	hsa-miR-21-5p	Microarray	18591254
MIRT053656	hsa-miR-145-5p	Microarray	22942087
MIRT756188	hsa-miR-429	Western blotting, qRT-PCR	35509844
MIRT1221212	hsa-miR-1257	CLIP-seq
MIRT1221213	hsa-miR-125a-3p	CLIP-seq
MIRT1221214	hsa-miR-125a-5p	CLIP-seq
MIRT1221215	hsa-miR-125b	CLIP-seq
MIRT1221216	hsa-miR-1265	CLIP-seq
MIRT1221217	hsa-miR-3132	CLIP-seq
MIRT1221218	hsa-miR-3200-5p	CLIP-seq
MIRT1221219	hsa-miR-4319	CLIP-seq
MIRT1221220	hsa-miR-4427	CLIP-seq
MIRT1221221	hsa-miR-4639-3p	CLIP-seq
MIRT1221222	hsa-miR-4650-3p	CLIP-seq
MIRT1221223	hsa-miR-4680-3p	CLIP-seq
MIRT1221224	hsa-miR-4732-3p	CLIP-seq
MIRT1221225	hsa-miR-4756-3p	CLIP-seq
MIRT1221226	hsa-miR-4764-5p	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT1221228	hsa-miR-610	CLIP-seq
MIRT1221229	hsa-miR-670	CLIP-seq
MIRT2063840	hsa-miR-224	CLIP-seq
MIRT1221217	hsa-miR-3132	CLIP-seq
MIRT2063841	hsa-miR-3185	CLIP-seq
MIRT2063842	hsa-miR-371-5p	CLIP-seq
MIRT2063843	hsa-miR-4420	CLIP-seq
MIRT1221221	hsa-miR-4639-3p	CLIP-seq
MIRT1221222	hsa-miR-4650-3p	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2439251	hsa-miR-3148	CLIP-seq
MIRT2439252	hsa-miR-331-5p	CLIP-seq
MIRT2439253	hsa-miR-4678	CLIP-seq
MIRT2439251	hsa-miR-3148	CLIP-seq
MIRT2439252	hsa-miR-331-5p	CLIP-seq
MIRT2439253	hsa-miR-4678	CLIP-seq
MIRT2590104	hsa-miR-103b	CLIP-seq
MIRT2590105	hsa-miR-1182	CLIP-seq
MIRT2590106	hsa-miR-1206	CLIP-seq
MIRT2590107	hsa-miR-1229	CLIP-seq
MIRT2590108	hsa-miR-1244	CLIP-seq
MIRT2590109	hsa-miR-138	CLIP-seq
MIRT2590110	hsa-miR-3117-3p	CLIP-seq
MIRT2590111	hsa-miR-3169	CLIP-seq
MIRT2590112	hsa-miR-325	CLIP-seq
MIRT2590113	hsa-miR-33a	CLIP-seq
MIRT2590114	hsa-miR-33b	CLIP-seq
MIRT2590115	hsa-miR-3620	CLIP-seq
MIRT2590116	hsa-miR-3653	CLIP-seq
MIRT2590117	hsa-miR-3658	CLIP-seq
MIRT2590118	hsa-miR-3672	CLIP-seq
MIRT2590119	hsa-miR-4317	CLIP-seq
MIRT2590120	hsa-miR-4422	CLIP-seq
MIRT2590121	hsa-miR-4496	CLIP-seq
MIRT2590122	hsa-miR-4509	CLIP-seq
MIRT2590123	hsa-miR-4511	CLIP-seq
MIRT2590124	hsa-miR-4667-3p	CLIP-seq
MIRT2590125	hsa-miR-4740-5p	CLIP-seq
MIRT2590126	hsa-miR-4759	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2590127	hsa-miR-512-5p	CLIP-seq
MIRT2590128	hsa-miR-545	CLIP-seq
MIRT2590129	hsa-miR-548b-3p	CLIP-seq
MIRT2590130	hsa-miR-548m	CLIP-seq
MIRT2590131	hsa-miR-549	CLIP-seq
MIRT2590132	hsa-miR-581	CLIP-seq
MIRT2590133	hsa-miR-659	CLIP-seq
MIRT2590134	hsa-miR-890	CLIP-seq
MIRT2590135	hsa-miR-892b	CLIP-seq
MIRT2590104	hsa-miR-103b	CLIP-seq
MIRT2590105	hsa-miR-1182	CLIP-seq
MIRT2590106	hsa-miR-1206	CLIP-seq
MIRT2590107	hsa-miR-1229	CLIP-seq
MIRT2590108	hsa-miR-1244	CLIP-seq
MIRT2590109	hsa-miR-138	CLIP-seq
MIRT2687454	hsa-miR-1827	CLIP-seq
MIRT2590110	hsa-miR-3117-3p	CLIP-seq
MIRT2687455	hsa-miR-3155	CLIP-seq
MIRT2687456	hsa-miR-3155b	CLIP-seq
MIRT2590111	hsa-miR-3169	CLIP-seq
MIRT2687457	hsa-miR-3173-3p	CLIP-seq
MIRT2687458	hsa-miR-323b-5p	CLIP-seq
MIRT2590112	hsa-miR-325	CLIP-seq
MIRT2590113	hsa-miR-33a	CLIP-seq
MIRT2590114	hsa-miR-33b	CLIP-seq
MIRT2687459	hsa-miR-3612	CLIP-seq
MIRT2590115	hsa-miR-3620	CLIP-seq
MIRT2590116	hsa-miR-3653	CLIP-seq
MIRT2590117	hsa-miR-3658	CLIP-seq
MIRT2590118	hsa-miR-3672	CLIP-seq
MIRT2590119	hsa-miR-4317	CLIP-seq
MIRT2687460	hsa-miR-4328	CLIP-seq
MIRT2590120	hsa-miR-4422	CLIP-seq
MIRT2687461	hsa-miR-4495	CLIP-seq
MIRT2590121	hsa-miR-4496	CLIP-seq
MIRT2590122	hsa-miR-4509	CLIP-seq
MIRT2590123	hsa-miR-4511	CLIP-seq
MIRT2590124	hsa-miR-4667-3p	CLIP-seq
MIRT2687462	hsa-miR-4695-5p	CLIP-seq
MIRT2687463	hsa-miR-4703-3p	CLIP-seq
MIRT2590125	hsa-miR-4740-5p	CLIP-seq
MIRT2590126	hsa-miR-4759	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2687464	hsa-miR-4799-5p	CLIP-seq
MIRT2687465	hsa-miR-484	CLIP-seq
MIRT2590127	hsa-miR-512-5p	CLIP-seq
MIRT2590128	hsa-miR-545	CLIP-seq
MIRT2590129	hsa-miR-548b-3p	CLIP-seq
MIRT2590130	hsa-miR-548m	CLIP-seq
MIRT2590131	hsa-miR-549	CLIP-seq
MIRT2590132	hsa-miR-581	CLIP-seq
MIRT2687466	hsa-miR-582-3p	CLIP-seq
MIRT2687467	hsa-miR-650	CLIP-seq
MIRT2590133	hsa-miR-659	CLIP-seq
MIRT2590134	hsa-miR-890	CLIP-seq
MIRT2590135	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IEA
GO:0072126	Process	Positive regulation of glomerular mesangial cell proliferation	IEA
GO:2000439	Process	Positive regulation of monocyte extravasation	IEA

Other IDs

• MIM: 609673
• HGNC: 30620
• e!Ensembl: ENSG00000170962

Protein

• UniProt ID: Q9GZP0
• Protein name: Platelet-derived growth factor D (PDGF-D) (Iris-expressed growth factor) (Spinal cord-derived growth factor B) (SCDGF-B) [Cleaved into: Platelet-derived growth factor D, latent form (PDGFD latent form); Platelet-derived growth factor D, receptor-binding f
• Protein function: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	272 → 362	PDGF/VEGF domain	Domain
  PF00431	CUB	53 → 167	CUB domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of th
• Sequence:

  MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
  NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
  ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
  TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
  LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
  RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
  DCICSSRPPR

• Sequence length: 370

Pathways

KEGG Pathway	Reactome Pathway
EGFR tyrosine kinase inhibitor resistance	Signaling by PDGF
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Choline metabolism in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	21378988, 34961328	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	35939300	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC HYPERTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	CTD, ClinGen, Disgenet CTD, ClinGen, Disgenet	23715323, 33187088, 33971972	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33907183	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (88)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29794241		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18573494, 18600092, 22476029, 24573017, 26362023		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	28346846		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16508943, 24989895	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29551627		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11980634		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	18573494, 18600092, 22476029, 24573017, 26362023		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26362023	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	22158043		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11980634		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20379844, 22038895, 29434852		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26157007	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24158561, 25760076, 36308081, 37253627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29240605	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22471482, 29240605		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28965749		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	22289441	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18600092, 22289441		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30251463, 30553841		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	25280005		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28035069, 29024195, 30836770		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29024195	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28346846		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30251463		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15994946		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22704460, 24573017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	22704460, 23364394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24573017, 35246263	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	22704460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	29955147, 30014607		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29955147, 30014607		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18600092		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18600092		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24646915		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24870786	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29240605		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34329340	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29955147, 30014607		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40530904	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	16510766		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30014607	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22289441	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18600092		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	22158043		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	30690033		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28346846		★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	22289441	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	18600092, 26362023		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16510766		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24158561		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11980634		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22471482, 29240605	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	11980634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20379844, 22038895, 29434852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24646915		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11980634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22471482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18339874, 18403754, 21098708, 22158043, 22689130, 26157007, 29024195		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20379844, 22038895, 22471482, 24646915, 27507215, 29434852, 30251463, 30652340		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11980634		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29024195		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25333347	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22613967		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27605433	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	27585990	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11980634, 12629513, 15994946, 18403754, 19885562, 20379844, 22038895, 23187740, 24646915, 26157007, 28035069, 30014607, 30553841		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	25333347		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16508943	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22471482		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22471482	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18056465		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29734187	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15988036, 18339874, 18403754, 21098708, 22158043, 22689130, 26157007, 29024195		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14996732, 18339874, 18403754, 19544444, 29024195	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18403754		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33187088, 33971972	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15994946		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24989895		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23187740		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17601708	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	30690033		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22289441	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34858395, 36245371, 36357874	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29410092		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PDGFC 13 shared pathwaysEGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, Focal adhesion, Gap junction, Regulation of actin cytoskeleton, Prostate cancer, Melanoma, Choline metabolism in cancer +1 more Related via 13 shared pathways including EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway. PDGFRB 13 shared pathwaysEGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, Focal adhesion, Gap junction, Regulation of actin cytoskeleton, Prostate cancer, Melanoma, Choline metabolism in cancer +1 more Related via 13 shared pathways including EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway. GGCX 2 shared diseasesIschemic heart disease, Pulmonary arterial hypertension 6 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), CTD (Pulmonary arterial hypertension), Disgenet (Pulmonary arterial hypertension), ClinGen (Pulmonary arterial hypertension) Related via 2 shared diseases including Ischemic heart disease, Pulmonary arterial hypertension — evidence mostly Disgenet. PDGFA 13 shared pathwaysEGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, Focal adhesion, Gap junction, Regulation of actin cytoskeleton, Prostate cancer, Melanoma, Choline metabolism in cancer +1 more Related via 13 shared pathways including EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway. PDGFB 1 shared diseaseProstatic hyperplasia 13 shared pathwaysEGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, Focal adhesion, Gap junction, Regulation of actin cytoskeleton, Prostate cancer, Melanoma, Choline metabolism in cancer +1 more 1 shared evidence sourceDisgenet (Prostatic hyperplasia) Related via 13 shared pathways including EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PDGFC	0	[]	13	["EGFR tyrosine kinase inhibitor resistance","MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Phospholipase D signaling pathway","Focal adhesion","Gap junction","Regulation of actin cytoskeleton","Prostate cancer","Melanoma","Choline metabolism in cancer"]	0	[]
PDGFRB	0	[]	13	["EGFR tyrosine kinase inhibitor resistance","MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Phospholipase D signaling pathway","Focal adhesion","Gap junction","Regulation of actin cytoskeleton","Prostate cancer","Melanoma","Choline metabolism in cancer"]	0	[]
GGCX	2	["Ischemic heart disease","Pulmonary arterial hypertension"]	0	[]	6	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","CTD (Pulmonary arterial hypertension)","Disgenet (Pulmonary arterial hypertension)","ClinGen (Pulmonary arterial hypertension)"]
PDGFA	0	[]	13	["EGFR tyrosine kinase inhibitor resistance","MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Phospholipase D signaling pathway","Focal adhesion","Gap junction","Regulation of actin cytoskeleton","Prostate cancer","Melanoma","Choline metabolism in cancer"]	0	[]
PDGFB	1	["Prostatic hyperplasia"]	13	["EGFR tyrosine kinase inhibitor resistance","MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Phospholipase D signaling pathway","Focal adhesion","Gap junction","Regulation of actin cytoskeleton","Prostate cancer","Melanoma","Choline metabolism in cancer"]	1	["Disgenet (Prostatic hyperplasia)"]

Diseases Linked via Similar Genes

Lung cancer Linked via 2 of 5 related genesPDGFC, GGCX Mesothelioma Linked via 2 of 5 related genesPDGFC, PDGFA Idiopathic basal ganglia calcification Linked via 2 of 5 related genesPDGFRB, PDGFB Basal ganglia disease Linked via 2 of 5 related genesPDGFRB, PDGFB Primary familial brain calcification Linked via 2 of 5 related genesPDGFRB, PDGFB

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Lung cancer	2	["PDGFC","GGCX"]
Mesothelioma	2	["PDGFC","PDGFA"]
Idiopathic basal ganglia calcification	2	["PDGFRB","PDGFB"]
Basal ganglia disease	2	["PDGFRB","PDGFB"]
Primary familial brain calcification	2	["PDGFRB","PDGFB"]