OXCT2 (3-oxoacid CoA-transferase 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 64064
Gene name 3-oxoacid CoA-transferase 2
Gene symbol OXCT2
Synonyms (NCBI Gene)
FKSG25SCOTT
Chromosome 1
Chromosome location 1p34.2
Summary The protein encoded by this gene catalyzes the transfer of a CoA group from succinate to acetoacetate and is an important enzyme in ketone body catabolism. The encoded protein localizes to the mitochondrion. This gene is intronless, and a pseudogene of th
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 11756565
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610289 18606 ENSG00000198754
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYC2
Protein name Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial (EC 2.8.3.5) (3-oxoacid CoA-transferase 2A) (Testis-specific succinyl-CoA:3-oxoacid CoA-transferase) (SCOT-t)
Protein function Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01144 CoA_trans 43 → 272 Coenzyme A transferase Domain
PF01144 CoA_trans 299 → 498 Coenzyme A transferase Domain
Tissue specificity TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:11756565}.
Sequence 
MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVM
IGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENT
LCESQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHL
ALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRAGNVVFRRSARNFNVPMCKAADV
TAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART
RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADL
INAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKE
LTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQQVAP
Sequence length 517
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Valine, leucine and isoleucine degradation Utilization of Ketone Bodies
Butanoate metabolism  
Metabolic pathways  
Sort by:
OXCT1 3 shared pathwaysValine, leucine and isoleucine degradation, Butanoate metabolism, Utilization of Ketone Bodies Related via 3 shared pathways including Valine, leucine and isoleucine degradation, Butanoate metabolism. AACS 2 shared pathwaysValine, leucine and isoleucine degradation, Butanoate metabolism Related via 2 shared pathways including Valine, leucine and isoleucine degradation, Butanoate metabolism. BDH1 2 shared pathwaysButanoate metabolism, Utilization of Ketone Bodies Related via 2 shared pathways including Butanoate metabolism, Utilization of Ketone Bodies. HMGCLL1 2 shared pathwaysValine, leucine and isoleucine degradation, Butanoate metabolism Related via 2 shared pathways including Valine, leucine and isoleucine degradation, Butanoate metabolism. HMGCL 2 shared pathwaysValine, leucine and isoleucine degradation, Butanoate metabolism Related via 2 shared pathways including Valine, leucine and isoleucine degradation, Butanoate metabolism.
Bipolar disorder Linked via 2 of 5 related genesOXCT1, AACS Osteoporosis Linked via 1 of 5 related genesOXCT1 Mitochondrial disease Linked via 1 of 5 related genesOXCT1 Parkinson disease Linked via 1 of 5 related genesAACS Scoliosis Linked via 1 of 5 related genesAACS