Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	219956
Gene name	Olfactory receptor family 9 subfamily Q member 1
Gene symbol	OR9Q1
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q12.1
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

82 Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT647135	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT647134	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT647133	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647130	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT647129	hsa-miR-4775	HITS-CLIP	23824327
MIRT647128	hsa-miR-3671	HITS-CLIP	23824327
MIRT647126	hsa-miR-607	HITS-CLIP	23824327
MIRT647135	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT647134	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT647133	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647132	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT647131	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT647130	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT647129	hsa-miR-4775	HITS-CLIP	23824327
MIRT647128	hsa-miR-3671	HITS-CLIP	23824327
MIRT647127	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT647126	hsa-miR-607	HITS-CLIP	23824327
MIRT647125	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT571151	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571150	hsa-miR-1236-5p	PAR-CLIP	20371350
MIRT571149	hsa-miR-4765	PAR-CLIP	20371350
MIRT571147	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT571148	hsa-miR-5087	PAR-CLIP	20371350
MIRT571151	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571150	hsa-miR-1236-5p	PAR-CLIP	20371350
MIRT571149	hsa-miR-4765	PAR-CLIP	20371350
MIRT571147	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT571148	hsa-miR-5087	PAR-CLIP	20371350
MIRT647135	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT647134	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT647133	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647130	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT647129	hsa-miR-4775	HITS-CLIP	23824327
MIRT647128	hsa-miR-3671	HITS-CLIP	23824327
MIRT647126	hsa-miR-607	HITS-CLIP	23824327
MIRT647135	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT647134	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT647133	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647132	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT647131	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT647130	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT647129	hsa-miR-4775	HITS-CLIP	23824327
MIRT647128	hsa-miR-3671	HITS-CLIP	23824327
MIRT647127	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT647126	hsa-miR-607	HITS-CLIP	23824327
MIRT647125	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT571151	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571150	hsa-miR-1236-5p	PAR-CLIP	20371350
MIRT571149	hsa-miR-4765	PAR-CLIP	20371350
MIRT571147	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT571148	hsa-miR-5087	PAR-CLIP	20371350
MIRT571151	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571150	hsa-miR-1236-5p	PAR-CLIP	20371350
MIRT571149	hsa-miR-4765	PAR-CLIP	20371350
MIRT571147	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT571148	hsa-miR-5087	PAR-CLIP	20371350
MIRT1204842	hsa-miR-1909	CLIP-seq
MIRT1204843	hsa-miR-3115	CLIP-seq
MIRT1204844	hsa-miR-3131	CLIP-seq
MIRT1204845	hsa-miR-34a	CLIP-seq
MIRT1204846	hsa-miR-34c-5p	CLIP-seq
MIRT1204847	hsa-miR-449a	CLIP-seq
MIRT1204848	hsa-miR-449b	CLIP-seq
MIRT1204849	hsa-miR-4790-3p	CLIP-seq
MIRT1204850	hsa-miR-611	CLIP-seq
MIRT1204851	hsa-miR-711	CLIP-seq
MIRT2059064	hsa-miR-3667-3p	CLIP-seq
MIRT2287241	hsa-miR-3183	CLIP-seq
MIRT2059064	hsa-miR-3667-3p	CLIP-seq
MIRT2287242	hsa-miR-4287	CLIP-seq
MIRT2287243	hsa-miR-4292	CLIP-seq
MIRT2287244	hsa-miR-4308	CLIP-seq
MIRT2287245	hsa-miR-4469	CLIP-seq
MIRT2287246	hsa-miR-4685-3p	CLIP-seq
MIRT2287247	hsa-miR-4723-3p	CLIP-seq
MIRT2287248	hsa-miR-511	CLIP-seq
MIRT2455683	hsa-miR-1324	CLIP-seq
MIRT2455684	hsa-miR-3653	CLIP-seq
MIRT2455685	hsa-miR-3658	CLIP-seq
MIRT2455686	hsa-miR-4511	CLIP-seq
MIRT2455687	hsa-miR-4773	CLIP-seq
MIRT2455688	hsa-miR-548b-3p	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NGQ5

Protein name

Olfactory receptor 9Q1

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	31 → 307	Olfactory receptor	Family

Sequence

MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMY
FLLSHLAFMDVCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAY
DRYLAVCQPLLYVTILTQQARLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCD
LPPLLKLTCGESYTQEVLIIMFAIFVIPASMVVILVSYLFIIVAIMGIPAGSQAKTFSTC
TSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVIPMLNPLIYSLRNKEVKEAL
RKILNRAKLS

Sequence length

310

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Olfactory transduction	Olfactory Signaling Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	29608257	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	29608257	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	33495597	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Endometrial Carcinoma	Endometrial carcinoma	GWASCAT_DG	29608257	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	GWASCAT_DG	29608257	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

OR9Q1 (olfactory receptor family 9 subfamily Q member 1)

Bookmark This Gene