OR2B2 (olfactory receptor family 2 subfamily B member 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 81697
Gene name Olfactory receptor family 2 subfamily B member 2
Gene symbol OR2B2
Synonyms (NCBI Gene)
OR2B2QOR2B9OR6-1dJ193B12.4hs6M1-10
Chromosome 6
Chromosome location 6p22.1
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2686852 hsa-miR-4423-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004984 Function Olfactory receptor activity IBA
GO:0004984 Function Olfactory receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GZK3
Protein name Olfactory receptor 2B2 (Hs6M1-10) (Olfactory receptor 2B9) (Olfactory receptor 6-1) (OR6-1)
Protein function Odorant receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13853 7tm_4 31 → 308 Olfactory receptor Family
Sequence 
MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTIILVSHVDFKLHTPMY
FFLSNLSLLDLCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIFLALGSTECLLLAVMCF
DRFVAICRPLHYSIIMHQRLCFQLAAASWISGFSNSVLQSTWTLKMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIQSAEGQRKAFGT
CGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGIIAPMLNPLIYTLRNKEVKEA
FKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPIFVITIENYCNLPQRKFP
Sequence length 357
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Olfactory transduction Olfactory Signaling Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (15)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 33654092, 35589863
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE — GWAS catalog 33909500
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE — GWAS catalog 33608531, 38102678
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA — GWAS catalog 35835914
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA — GWAS catalog 28604730
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Diabetes Diabetes GWASCAT_DG 31451708
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus GWASCAT_DG 31451708
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
TERF1 3 shared diseasesGastroesophageal reflux disease, Peptic ulcer disease, Post-traumatic stress disorder 3 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Peptic ulcer disease), GWAS catalog (Post-traumatic stress disorder) Related via 3 shared diseases including Gastroesophageal reflux disease, Peptic ulcer disease — evidence mostly GWAS catalog. ELFN1 3 shared diseasesGastroesophageal reflux disease, Peptic ulcer disease, Post-traumatic stress disorder 3 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Peptic ulcer disease), GWAS catalog (Post-traumatic stress disorder) Related via 3 shared diseases including Gastroesophageal reflux disease, Peptic ulcer disease — evidence mostly GWAS catalog. CR1L 2 shared diseasesGastroesophageal reflux disease, Peptic ulcer disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Peptic ulcer disease) Related via 2 shared diseases including Gastroesophageal reflux disease, Peptic ulcer disease — evidence mostly GWAS catalog. PCDHA3 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. PCDHA4 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog.
Schizophrenia Linked via 2 of 5 related genesPCDHA3, PCDHA4 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesELFN1 Coronary artery disease Linked via 1 of 5 related genesELFN1 Diverticular disease Linked via 1 of 5 related genesELFN1 Myocardial infarction Linked via 1 of 5 related genesELFN1