OPN3 (opsin 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23596
• Gene name: Opsin 3
• Gene symbol: OPN3
• Synonyms (NCBI Gene): ECPN, PPP1R116
• Chromosome: 1
• Chromosome location: 1q43
• Summary: Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3

miRNA Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047044	hsa-miR-183-5p	CLASH	23622248
MIRT1204414	hsa-miR-1287	CLIP-seq
MIRT1204415	hsa-miR-296-5p	CLIP-seq
MIRT1204416	hsa-miR-3074-5p	CLIP-seq
MIRT1204417	hsa-miR-3135b	CLIP-seq
MIRT1204418	hsa-miR-3167	CLIP-seq
MIRT1204419	hsa-miR-3177-5p	CLIP-seq
MIRT1204420	hsa-miR-3619-3p	CLIP-seq
MIRT1204421	hsa-miR-370	CLIP-seq
MIRT1204422	hsa-miR-377	CLIP-seq
MIRT1204423	hsa-miR-4457	CLIP-seq
MIRT1204424	hsa-miR-4643	CLIP-seq
MIRT1204425	hsa-miR-4776-5p	CLIP-seq
MIRT1204426	hsa-miR-495	CLIP-seq
MIRT1204427	hsa-miR-567	CLIP-seq
MIRT1204428	hsa-miR-624	CLIP-seq
MIRT1204429	hsa-miR-876-5p	CLIP-seq
MIRT2058985	hsa-miR-101	CLIP-seq
MIRT2058986	hsa-miR-1237	CLIP-seq
MIRT2058987	hsa-miR-1248	CLIP-seq
MIRT2058985	hsa-miR-101	CLIP-seq
MIRT2287078	hsa-miR-1275	CLIP-seq
MIRT2287079	hsa-miR-205	CLIP-seq
MIRT2287080	hsa-miR-217	CLIP-seq
MIRT2287081	hsa-miR-299-3p	CLIP-seq
MIRT2287082	hsa-miR-3117-5p	CLIP-seq
MIRT2287083	hsa-miR-3137	CLIP-seq
MIRT2287084	hsa-miR-3153	CLIP-seq
MIRT2287085	hsa-miR-3163	CLIP-seq
MIRT1204419	hsa-miR-3177-5p	CLIP-seq
MIRT1204422	hsa-miR-377	CLIP-seq
MIRT2287086	hsa-miR-4260	CLIP-seq
MIRT2287087	hsa-miR-4271	CLIP-seq
MIRT2287088	hsa-miR-4292	CLIP-seq
MIRT2287089	hsa-miR-4308	CLIP-seq
MIRT2287090	hsa-miR-4418	CLIP-seq
MIRT2287091	hsa-miR-4427	CLIP-seq
MIRT2287092	hsa-miR-4491	CLIP-seq
MIRT2287093	hsa-miR-4525	CLIP-seq
MIRT1204424	hsa-miR-4643	CLIP-seq
MIRT2287094	hsa-miR-4648	CLIP-seq
MIRT2287095	hsa-miR-4654	CLIP-seq
MIRT2287096	hsa-miR-4657	CLIP-seq
MIRT2287097	hsa-miR-4665-5p	CLIP-seq
MIRT2287098	hsa-miR-4668-5p	CLIP-seq
MIRT2287099	hsa-miR-4688	CLIP-seq
MIRT2287100	hsa-miR-4709-5p	CLIP-seq
MIRT2287101	hsa-miR-4723-5p	CLIP-seq
MIRT2287102	hsa-miR-4725-3p	CLIP-seq
MIRT2287103	hsa-miR-4738-3p	CLIP-seq
MIRT2287104	hsa-miR-4769-5p	CLIP-seq
MIRT2287105	hsa-miR-486-3p	CLIP-seq
MIRT2287106	hsa-miR-500a	CLIP-seq
MIRT2287107	hsa-miR-509-3-5p	CLIP-seq
MIRT2287108	hsa-miR-509-5p	CLIP-seq
MIRT1204427	hsa-miR-567	CLIP-seq
MIRT2287109	hsa-miR-625	CLIP-seq
MIRT2287110	hsa-miR-627	CLIP-seq
MIRT2287111	hsa-miR-668	CLIP-seq
MIRT2287112	hsa-miR-924	CLIP-seq

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10234000
GO:0005502	Function	11-cis retinal binding	IDA	31097585
GO:0005503	Function	All-trans retinal binding	IDA	31097585
GO:0005515	Function	Protein binding	IPI	31097585
GO:0005737	Component	Cytoplasm	IDA	30168605
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30168605, 31097585, 31380578, 31730232
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10234000
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10234000
GO:0007602	Process	Phototransduction	IBA
GO:0007602	Process	Phototransduction	IEA
GO:0007602	Process	Phototransduction	NAS	10234000
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0008020	Function	G protein-coupled photoreceptor activity	NAS	10234000
GO:0009583	Process	Detection of light stimulus	NAS	10234000
GO:0009584	Process	Detection of visible light	IEA
GO:0009637	Process	Response to blue light	IDA	30168605
GO:0009637	Process	Response to blue light	IEA
GO:0009637	Process	Response to blue light	IMP	28842328
GO:0009881	Function	Photoreceptor activity	IEA
GO:0009881	Function	Photoreceptor activity	NAS	10234000
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10234000
GO:0030216	Process	Keratinocyte differentiation	IMP	30168605
GO:0042752	Process	Regulation of circadian rhythm	NAS	10234000
GO:0043066	Process	Negative regulation of apoptotic process	IMP	31730232
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0048022	Process	Negative regulation of melanin biosynthetic process	IMP	31097585
GO:0048023	Process	Positive regulation of melanin biosynthetic process	IMP	28842328
GO:0071482	Process	Cellular response to light stimulus	IBA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:1901857	Process	Positive regulation of cellular respiration	IEA

Other IDs

• MIM: 606695
• HGNC: 14007
• e!Ensembl: ENSG00000054277

Protein

• UniProt ID: Q9H1Y3
• Protein name: Opsin-3 (Encephalopsin) (Panopsin)
• Protein function: G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin (PubMed:28842328, PubMed:31097585, PubMed:31380578). Binds both 11-cis retinal and all-trans retinal (PubMed:31097585
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	58 → 309	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in tracheal airway smooth muscle (at protein level) (PubMed:30284927). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level) (PubMed:30168605). Exp
• Sequence:

  MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNL
  LVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFS
  GSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYI
  LDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQT
  IQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKS
  NTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRP
  KKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL

• Sequence length: 402

Pathways

Reactome Pathway

G alpha (i) signalling events

Opsins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	33574088	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT RESISTANT DEPRESSION	—	GWAS catalog	30468137	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31802643		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18344558, 20425513		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18344558		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31802643	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22313545		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33955704	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33955704	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	35577105	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33955704	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	35577105	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29379995		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23006423		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39487504	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39487504	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RRH 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins. OPN5 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins. RGR 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins. OPN1MW3 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins. OPN1MW 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RRH	0	[]	2	["G alpha (i) signalling events","Opsins"]	0	[]
OPN5	0	[]	2	["G alpha (i) signalling events","Opsins"]	0	[]
RGR	0	[]	2	["G alpha (i) signalling events","Opsins"]	0	[]
OPN1MW3	0	[]	2	["G alpha (i) signalling events","Opsins"]	0	[]
OPN1MW	0	[]	2	["G alpha (i) signalling events","Opsins"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 2 of 5 related genesRRH, OPN1MW Nephrotic syndrome Linked via 1 of 5 related genesOPN5 Peripheral arterial disease Linked via 1 of 5 related genesOPN5 Cone dystrophy Linked via 1 of 5 related genesRGR Eye disease Linked via 1 of 5 related genesRGR

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	2	["RRH","OPN1MW"]
Nephrotic syndrome	1	["OPN5"]
Peripheral arterial disease	1	["OPN5"]
Cone dystrophy	1	["RGR"]
Eye disease	1	["RGR"]