OPN1MW3 (opsin 1, medium wave sensitive 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101060233
Gene name Opsin 1, medium wave sensitive 3
Gene symbol OPN1MW3
Synonyms (NCBI Gene)
GCPGOPOPN1MWOPN1MW2
Chromosome X
Chromosome location Xq28
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001750 Component Photoreceptor outer segment IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DN78
Protein name Medium-wave-sensitive opsin 3 (Green cone photoreceptor pigment) (Green-sensitive opsin) (GOP) (opsin 1 cone pigments medium-wave-sensitive 3)
Protein function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 70 → 322 7 transmembrane receptor (rhodopsin family) Family
Sequence 
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFH
PLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
Sequence length 364
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
The retinoid cycle in cones (daylight vision)
Retinoid cycle disease events
G alpha (i) signalling events
Opsins
Sort by:
OPN1MW 4 shared pathwaysG alpha (i) signalling events, The retinoid cycle in cones (daylight vision), Retinoid cycle disease events, Opsins Related via 4 shared pathways including G alpha (i) signalling events, The retinoid cycle in cones (daylight vision). OPN1SW 4 shared pathwaysG alpha (i) signalling events, The retinoid cycle in cones (daylight vision), Retinoid cycle disease events, Opsins Related via 4 shared pathways including G alpha (i) signalling events, The retinoid cycle in cones (daylight vision). OPN1MW2 4 shared pathwaysG alpha (i) signalling events, The retinoid cycle in cones (daylight vision), Retinoid cycle disease events, Opsins Related via 4 shared pathways including G alpha (i) signalling events, The retinoid cycle in cones (daylight vision). RRH 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins. OPN5 2 shared pathwaysG alpha (i) signalling events, Opsins Related via 2 shared pathways including G alpha (i) signalling events, Opsins.
Color vision deficiency Linked via 3 of 5 related genesOPN1MW, OPN1SW, RRH Blue cone monochromatism Linked via 2 of 5 related genesOPN1MW, OPN1SW Deuteranomaly Linked via 2 of 5 related genesOPN1MW, OPN1MW2 Cone dystrophy, x-linked Linked via 1 of 5 related genesOPN1MW Cone monochromatism Linked via 1 of 5 related genesOPN1MW