Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4957
Gene name	Outer dense fiber of sperm tails 2
Gene symbol	ODF2
Synonyms (NCBI Gene)	CT134ODF2/1ODF2/2ODF84
Chromosome	9
Chromosome location	9q34.11
Summary	The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail

128 Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020042	hsa-miR-375	Microarray	20215506
MIRT030045	hsa-miR-26b-5p	Microarray	19088304
MIRT1202138	hsa-miR-1237	CLIP-seq
MIRT1202139	hsa-miR-1256	CLIP-seq
MIRT1202140	hsa-miR-1266	CLIP-seq
MIRT1202141	hsa-miR-1302	CLIP-seq
MIRT1202142	hsa-miR-203	CLIP-seq
MIRT1202143	hsa-miR-29a	CLIP-seq
MIRT1202144	hsa-miR-29b	CLIP-seq
MIRT1202145	hsa-miR-29c	CLIP-seq
MIRT1202146	hsa-miR-3122	CLIP-seq
MIRT1202147	hsa-miR-3140-3p	CLIP-seq
MIRT1202148	hsa-miR-3180-5p	CLIP-seq
MIRT1202149	hsa-miR-3199	CLIP-seq
MIRT1202150	hsa-miR-3646	CLIP-seq
MIRT1202151	hsa-miR-3660	CLIP-seq
MIRT1202152	hsa-miR-3662	CLIP-seq
MIRT1202153	hsa-miR-3664-3p	CLIP-seq
MIRT1202154	hsa-miR-377	CLIP-seq
MIRT1202155	hsa-miR-3913-5p	CLIP-seq
MIRT1202156	hsa-miR-4298	CLIP-seq
MIRT1202157	hsa-miR-4476	CLIP-seq
MIRT1202158	hsa-miR-4518	CLIP-seq
MIRT1202159	hsa-miR-4526	CLIP-seq
MIRT1202160	hsa-miR-4533	CLIP-seq
MIRT1202161	hsa-miR-4642	CLIP-seq
MIRT1202162	hsa-miR-4645-3p	CLIP-seq
MIRT1202163	hsa-miR-4719	CLIP-seq
MIRT1202164	hsa-miR-4756-3p	CLIP-seq
MIRT1202165	hsa-miR-498	CLIP-seq
MIRT1202166	hsa-miR-520a-5p	CLIP-seq
MIRT1202167	hsa-miR-525-5p	CLIP-seq
MIRT1202168	hsa-miR-586	CLIP-seq
MIRT1202169	hsa-miR-610	CLIP-seq
MIRT1202170	hsa-miR-873	CLIP-seq
MIRT1202171	hsa-miR-1244	CLIP-seq
MIRT1202172	hsa-miR-1263	CLIP-seq
MIRT1202173	hsa-miR-1275	CLIP-seq
MIRT1202174	hsa-miR-302a	CLIP-seq
MIRT1202175	hsa-miR-302b	CLIP-seq
MIRT1202176	hsa-miR-302c	CLIP-seq
MIRT1202177	hsa-miR-302d	CLIP-seq
MIRT1202178	hsa-miR-302e	CLIP-seq
MIRT1202179	hsa-miR-3153	CLIP-seq
MIRT1202180	hsa-miR-3189-3p	CLIP-seq
MIRT1202181	hsa-miR-3591-3p	CLIP-seq
MIRT1202182	hsa-miR-3611	CLIP-seq
MIRT1202183	hsa-miR-3616-5p	CLIP-seq
MIRT1202184	hsa-miR-3647-5p	CLIP-seq
MIRT1202152	hsa-miR-3662	CLIP-seq
MIRT1202185	hsa-miR-3677-5p	CLIP-seq
MIRT1202186	hsa-miR-372	CLIP-seq
MIRT1202187	hsa-miR-373	CLIP-seq
MIRT1202188	hsa-miR-4477b	CLIP-seq
MIRT1202189	hsa-miR-4488	CLIP-seq
MIRT1202190	hsa-miR-4536	CLIP-seq
MIRT1202191	hsa-miR-4665-5p	CLIP-seq
MIRT1202192	hsa-miR-4668-5p	CLIP-seq
MIRT1202193	hsa-miR-4697-5p	CLIP-seq
MIRT1202194	hsa-miR-4753-5p	CLIP-seq
MIRT1202195	hsa-miR-4757-5p	CLIP-seq
MIRT1202196	hsa-miR-4795-5p	CLIP-seq
MIRT1202197	hsa-miR-513a-3p	CLIP-seq
MIRT1202198	hsa-miR-520a-3p	CLIP-seq
MIRT1202199	hsa-miR-520b	CLIP-seq
MIRT1202200	hsa-miR-520c-3p	CLIP-seq
MIRT1202201	hsa-miR-520d-3p	CLIP-seq
MIRT1202202	hsa-miR-520e	CLIP-seq
MIRT1202203	hsa-miR-520f	CLIP-seq
MIRT1202204	hsa-miR-570	CLIP-seq
MIRT1202205	hsa-miR-573	CLIP-seq
MIRT1202206	hsa-miR-636	CLIP-seq
MIRT1202207	hsa-miR-138	CLIP-seq
MIRT1202208	hsa-miR-1470	CLIP-seq
MIRT1202209	hsa-miR-299-5p	CLIP-seq
MIRT1202210	hsa-miR-3148	CLIP-seq
MIRT1202211	hsa-miR-3165	CLIP-seq
MIRT1202149	hsa-miR-3199	CLIP-seq
MIRT1202182	hsa-miR-3611	CLIP-seq
MIRT1202212	hsa-miR-3616-3p	CLIP-seq
MIRT1202151	hsa-miR-3660	CLIP-seq
MIRT1202213	hsa-miR-370	CLIP-seq
MIRT738846	hsa-miR-3907	CLIP-seq
MIRT1202214	hsa-miR-3936	CLIP-seq
MIRT1202215	hsa-miR-4446-3p	CLIP-seq
MIRT1202216	hsa-miR-4456	CLIP-seq
MIRT1202217	hsa-miR-4515	CLIP-seq
MIRT1202159	hsa-miR-4526	CLIP-seq
MIRT1202162	hsa-miR-4645-3p	CLIP-seq
MIRT1202218	hsa-miR-4652-5p	CLIP-seq
MIRT1202219	hsa-miR-4667-3p	CLIP-seq
MIRT1202220	hsa-miR-4668-3p	CLIP-seq
MIRT1202221	hsa-miR-4675	CLIP-seq
MIRT738844	hsa-miR-4690-3p	CLIP-seq
MIRT1202222	hsa-miR-4721	CLIP-seq
MIRT1202223	hsa-miR-4741	CLIP-seq
MIRT1202224	hsa-miR-548ac	CLIP-seq
MIRT1202225	hsa-miR-548c-3p	CLIP-seq
MIRT1202226	hsa-miR-548d-3p	CLIP-seq
MIRT1202227	hsa-miR-548z	CLIP-seq
MIRT738845	hsa-miR-600	CLIP-seq
MIRT1202228	hsa-miR-642a	CLIP-seq
MIRT738846	hsa-miR-3907	CLIP-seq
MIRT738844	hsa-miR-4690-3p	CLIP-seq
MIRT738845	hsa-miR-600	CLIP-seq
MIRT2058374	hsa-miR-135a	CLIP-seq
MIRT2058375	hsa-miR-135b	CLIP-seq
MIRT2058376	hsa-miR-182	CLIP-seq
MIRT2058377	hsa-miR-3125	CLIP-seq
MIRT2058378	hsa-miR-3192	CLIP-seq
MIRT1202213	hsa-miR-370	CLIP-seq
MIRT2058379	hsa-miR-3916	CLIP-seq
MIRT2058380	hsa-miR-4420	CLIP-seq
MIRT2058381	hsa-miR-4733-3p	CLIP-seq
MIRT2058382	hsa-miR-5096	CLIP-seq
MIRT2058383	hsa-miR-548aa	CLIP-seq
MIRT1202138	hsa-miR-1237	CLIP-seq
MIRT1202141	hsa-miR-1302	CLIP-seq
MIRT2058374	hsa-miR-135a	CLIP-seq
MIRT2058375	hsa-miR-135b	CLIP-seq
MIRT2058376	hsa-miR-182	CLIP-seq
MIRT1202146	hsa-miR-3122	CLIP-seq
MIRT1202147	hsa-miR-3140-3p	CLIP-seq
MIRT1202149	hsa-miR-3199	CLIP-seq
MIRT1202155	hsa-miR-3913-5p	CLIP-seq
MIRT2286691	hsa-miR-412	CLIP-seq
MIRT1202156	hsa-miR-4298	CLIP-seq
MIRT2286692	hsa-miR-590-3p	CLIP-seq

32 Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005198	Function	Structural molecule activity	TAS	10072582
GO:0005515	Function	Protein binding	IPI	16980960, 23355646, 28422092, 30683861, 32296183, 32814053, 35709258
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614, 24157919
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IDA	17646400, 24421332
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IDA	17646400
GO:0005929	Component	Cilium	IDA	17646400
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008104	Process	Intracellular protein localization	IMP	23213374, 28422092
GO:0010457	Process	Centriole-centriole cohesion	IGI	23213374
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0030154	Process	Cell differentiation	IEA
GO:0031267	Function	Small GTPase binding	IPI	17646400
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IDA	17646400
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044782	Process	Cilium organization	IGI	23400999
GO:0097225	Component	Sperm midpiece	ISS
GO:0097228	Component	Sperm principal piece	ISS
GO:0120103	Component	Centriolar subdistal appendage	IDA	23213374
GO:1902017	Process	Regulation of cilium assembly	IBA
GO:1902017	Process	Regulation of cilium assembly	IMP	17646400

MIM	HGNC	e!Ensembl
602015	8114	ENSG00000136811

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q5BJF6
Protein name	Outer dense fiber protein 2 (Cenexin) (Outer dense fiber of sperm tails protein 2)
Protein function	Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elas
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails. {ECO:0000269\|PubMed:10381817}.
Sequence	MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVR VKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKM NRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLR HNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQ MTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEA DSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAEN SRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYA EQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLE EKMREDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYE GMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLP DILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENK QLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIE DARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLK DRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA
Sequence length	829
Interactions	View interactions

Reactome Pathway
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SDCCAG8	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP250	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
HAUS1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
NEDD1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP164	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]

ODF2 (outer dense fiber of sperm tails 2)

Bookmark This Gene