NUDT9 (nudix hydrolase 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 53343
Gene name Nudix hydrolase 9
Gene symbol NUDT9
Synonyms (NCBI Gene)
NUDT10
Chromosome 4
Chromosome location 4q22.1
Summary The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes th
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT039805 hsa-miR-615-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20 Show/Hide all (20)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 37343711
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 37343711
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606022 8056 ENSG00000170502
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BW91
Protein name ADP-ribose pyrophosphatase, mitochondrial (EC 3.6.1.13) (ADP-ribose diphosphatase) (ADP-ribose phosphohydrolase) (Adenosine diphosphoribose pyrophosphatase) (ADPR-PPase) (Nucleoside diphosphate-linked moiety X motif 9) (Nudix motif 9)
Protein function Hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate.
PDB 1Q33 , 1QVJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 191 → 331 NUDIX domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed but isoform 1 is the most predominant isoform. {ECO:0000269|PubMed:12427752}.
Sequence 
MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKEN
SHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNF
SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR
DSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQ
KTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLML
EAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Purine metabolism Phosphate bond hydrolysis by NUDT proteins
Metabolic pathways  
Sort by:
NUDT5 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins. ADPRM 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins. NUDT16 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins.
Asthma Linked via 1 of 3 related genesNUDT5 Periodontitis Linked via 1 of 3 related genesNUDT5 Prostate cancer Linked via 1 of 3 related genesNUDT5 Diabetes mellitus type 2 Linked via 1 of 3 related genesNUDT5