ADPRM (ADP-ribose/CDP-alcohol diphosphatase, manganese dependent)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 56985
Gene name ADP-ribose/CDP-alcohol diphosphatase, manganese dependent
Gene symbol ADPRM
Synonyms (NCBI Gene)
C17orf48MDS006NBLA03831
Chromosome 17
Chromosome location 17p13.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol TAS
GO:0008663 Function 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity IBA
GO:0016787 Function Hydrolase activity IEA
GO:0030145 Function Manganese ion binding IBA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621211 30925 ENSG00000170222
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3LIE5
Protein name Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (EC 3.6.1.13) (EC 3.6.1.16) (EC 3.6.1.53) (ADPRibase-Mn) (CDP-choline phosphohydrolase)
Protein function Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which acti
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00149 Metallophos 18 → 282 Calcineurin-like phosphoesterase Domain
Sequence 
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN
NESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREY
LTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKY
EQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVS
HLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVI
ETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
Sequence length 342
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Purine metabolism Phosphate bond hydrolysis by NUDT proteins
Glycerophospholipid metabolism  
Metabolic pathways  
Sort by:
NUDT5 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins. NUDT9 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins. NUDT16 2 shared pathwaysPurine metabolism, Phosphate bond hydrolysis by NUDT proteins Related via 2 shared pathways including Purine metabolism, Phosphate bond hydrolysis by NUDT proteins.
Asthma Linked via 1 of 3 related genesNUDT5 Periodontitis Linked via 1 of 3 related genesNUDT5 Prostate cancer Linked via 1 of 3 related genesNUDT5 Diabetes mellitus type 2 Linked via 1 of 3 related genesNUDT5