Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	25961
Gene name	Nudix hydrolase 13
Gene symbol	NUDT13
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q22.2

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044955	hsa-miR-186-5p	CLASH	23622248
MIRT1197536	hsa-miR-129-5p	CLIP-seq
MIRT1197537	hsa-miR-30a	CLIP-seq
MIRT1197538	hsa-miR-30b	CLIP-seq
MIRT1197539	hsa-miR-30c	CLIP-seq
MIRT1197540	hsa-miR-30d	CLIP-seq
MIRT1197541	hsa-miR-30e	CLIP-seq
MIRT1197542	hsa-miR-3119	CLIP-seq
MIRT1197543	hsa-miR-342-3p	CLIP-seq
MIRT1197544	hsa-miR-4641	CLIP-seq
MIRT1197545	hsa-miR-892b	CLIP-seq
MIRT2057185	hsa-miR-4659a-3p	CLIP-seq
MIRT2057186	hsa-miR-4659b-3p	CLIP-seq
MIRT2057187	hsa-miR-514	CLIP-seq
MIRT2057188	hsa-miR-514b-3p	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000210	Function	NAD+ diphosphatase activity	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0010943	Function	NADPH pyrophosphatase activity	IEA
GO:0015949	Process	Nucleobase-containing small molecule interconversion	TAS
GO:0016462	Function	Pyrophosphatase activity	IEA
GO:0016462	Function	Pyrophosphatase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0035529	Function	NADH pyrophosphatase activity	IEA
GO:0035529	Function	NADH pyrophosphatase activity	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0055086	Process	Nucleobase-containing small molecule metabolic process	IEA

MIM	HGNC	e!Ensembl
609233	18827	ENSG00000166321

Q86X67

Protein name

NAD(P)H pyrophosphatase NUDT13, mitochondrial (EC 3.6.1.22) (Nucleoside diphosphate-linked moiety X motif 13) (Nudix motif 13) (Protein KiSS-16)

Protein function

NAD(P)H pyrophosphatase that hydrolyzes NADH into NMNH and AMP, and NADPH into NMNH and 2',5'-ADP. Has a marked preference for the reduced pyridine nucleotides. Does not show activity toward NAD-capped RNAs; the NAD-cap is an atypical cap presen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00293	NUDIX	196 → 319	NUDIX domain	Domain
PF09296	NUDIX-like	46 → 162	NADH pyrophosphatase-like rudimentary NUDIX domain	Domain
PF09297	zf-NADH-PPase	164 → 195	NADH pyrophosphatase zinc ribbon domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in metastasis-suppressed chromosome 6 melanoma hybrids. {ECO:0000269|Ref.6}.

Sequence

MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQ
TSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISA
SLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNV
AGSKRVCPSNNIIYYPQMAPVAITLVSDGTRCLLARQSSFPKGMYSALAGFCDIGESVEE
TIRREVAEEVGLEVESLQYYASQHWPFPSGSLMIACHATVKPGQTEIQVNLRELETAAWF
SHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA

Sequence length

352

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Nicotinate and nicotinamide metabolism	Interconversion of nucleotide di- and triphosphates
Metabolic pathways
Peroxisome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38092774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26872374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26872374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26872374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NUDT13 (nudix hydrolase 13)

Bookmark This Gene