NNMT (nicotinamide N-methyltransferase)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4837
Gene name Nicotinamide N-methyltransferase
Gene symbol NNMT
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q23.2
Summary N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 200
miRNA miRNA information provided by mirtarbase database.
20 Show/Hide all (20)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT022959 hsa-miR-124-3p Microarray 18668037
MIRT027710 hsa-miR-98-5p Microarray 19088304
MIRT689992 hsa-miR-3614-5p HITS-CLIP 23313552
MIRT689991 hsa-miR-6500-3p HITS-CLIP 23313552
MIRT689990 hsa-miR-4768-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0006769 Process Nicotinamide metabolic process IDA 8182091, 21823666
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
600008 7861 ENSG00000166741
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P40261
Protein name Nicotinamide N-methyltransferase (EC 2.1.1.1)
Protein function Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PubMed:21823666, PubMed:23
PDB 2IIP , 3ROD , 5YJF , 6CHH , 6ORR , 6PVE , 6PVS , 7BKG , 7BLE , 7EGU , 7EHZ , 7EI2 , 7ET7 , 7EU5 , 7NBJ , 7NBM , 7NBQ , 7RKK , 7RKL , 7SOK , 7WMC , 7WMT , 9ATV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01234 NNMT_PNMT_TEMT 1 → 259 NNMT/PNMT/TEMT family Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas. {ECO:0000269|PubMed:8182091}.
Sequence 
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
Sequence length 264
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Nicotinate and nicotinamide metabolism Methylation
Metabolic pathways Nicotinamide salvaging
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ASTHMA — GWAS catalog 21804549, 29273806
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL — CTD 36428691
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR — CTD 28284560
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (138)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 19020309, 19775302
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoid Cystic Carcinoma Adenocarcinoma BEFREE 29277772
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 19020309
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 15849667 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 33387303 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Dissection Aortic dissection Pubtator 36818541 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arterial Occlusive Diseases Arterial Occlusive Disease BEFREE 22721676
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 28174167
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 28174167
★★★★★
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 24004542
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
NUDT12 2 shared pathwaysNicotinate and nicotinamide metabolism, Nicotinamide salvaging Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Nicotinamide salvaging. NAPRT 2 shared pathwaysNicotinate and nicotinamide metabolism, Nicotinamide salvaging Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Nicotinamide salvaging. NAMPT 2 shared pathwaysNicotinate and nicotinamide metabolism, Nicotinamide salvaging Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Nicotinamide salvaging.
Alzheimer disease Linked via 1 of 3 related genesNUDT12 Congenital anomalies of kidney and urinary tract Linked via 1 of 3 related genesNUDT12 Crohn disease Linked via 1 of 3 related genesNUDT12 Dementia Linked via 1 of 3 related genesNUDT12 Inflammatory bowel disease Linked via 1 of 3 related genesNUDT12