NLRX1 (NLR family member X1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79671
• Gene name: NLR family member X1
• Gene symbol: NLRX1
• Synonyms (NCBI Gene): CLR11.3, DLNB26, NOD26, NOD5, NOD9
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: The protein encoded by this gene is a member of the NLR family and localizes to the outer mitochondrial membrane. The encoded protein is a regulator of mitochondrial antivirus responses. Three transcript variants encoding the same protein have been found

miRNA Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022772	hsa-miR-124-3p	Microarray	18668037
MIRT043504	hsa-miR-331-3p	CLASH	23622248
MIRT1187326	hsa-miR-149	CLIP-seq
MIRT1187327	hsa-miR-1910	CLIP-seq
MIRT1187328	hsa-miR-24	CLIP-seq
MIRT1187329	hsa-miR-3157-3p	CLIP-seq
MIRT1187330	hsa-miR-3166	CLIP-seq
MIRT1187331	hsa-miR-3616-3p	CLIP-seq
MIRT1187332	hsa-miR-3622b-5p	CLIP-seq
MIRT1187333	hsa-miR-4264	CLIP-seq
MIRT1187334	hsa-miR-4266	CLIP-seq
MIRT1187335	hsa-miR-4284	CLIP-seq
MIRT1187336	hsa-miR-4426	CLIP-seq
MIRT1187337	hsa-miR-455-3p	CLIP-seq
MIRT1187338	hsa-miR-4647	CLIP-seq
MIRT1187339	hsa-miR-4662b	CLIP-seq
MIRT1187340	hsa-miR-4695-5p	CLIP-seq
MIRT1187341	hsa-miR-4720-5p	CLIP-seq
MIRT1187342	hsa-miR-4779	CLIP-seq
MIRT1187343	hsa-miR-4799-3p	CLIP-seq
MIRT1187344	hsa-miR-576-3p	CLIP-seq
MIRT1187345	hsa-miR-892b	CLIP-seq
MIRT2054272	hsa-miR-1252	CLIP-seq
MIRT2054273	hsa-miR-3612	CLIP-seq
MIRT2054274	hsa-miR-650	CLIP-seq
MIRT2391613	hsa-miR-1296	CLIP-seq
MIRT2391614	hsa-miR-2909	CLIP-seq
MIRT2391615	hsa-miR-3545-5p	CLIP-seq
MIRT2391616	hsa-miR-4512	CLIP-seq
MIRT2391617	hsa-miR-4640-5p	CLIP-seq
MIRT2391618	hsa-miR-4726-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	18200010, 21903422, 28611246
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0016020	Component	Membrane	IEA
GO:0032688	Process	Negative regulation of interferon-beta production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IBA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA

Other IDs

• MIM: 611947
• HGNC: 29890
• e!Ensembl: ENSG00000160703

Protein

• UniProt ID: Q86UT6
• Protein name: NLR family member X1 (Caterpiller protein 11.3) (CLR11.3) (Nucleotide-binding oligomerization domain protein 5) (Nucleotide-binding oligomerization domain protein 9)
• Protein function: Participates in antiviral signaling. Acts as a negative regulator of MAVS-mediated antiviral responses, through the inhibition of the virus-induced RLH (RIG-like helicase)-MAVS interaction (PubMed:18200010). Instead, promotes autophagy by intera
• PDB: 3UN9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05729	NACHT	160 → 325	NACHT domain	Domain
  PF13516	LRR_6	805 → 828	Leucine Rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Strongest expression in mammary gland, heart and muscle. Detected in HeLa, HEK293T, THP-1, HL-60, Raji and Jurkat cell lines (at protein level). {ECO:0000269|PubMed:15952891, ECO:0000269|PubMed:18200010, ECO:000
• Sequence:

  MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSA
  PPPGRHGRLFPSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
  DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
  LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
  LHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
  KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEG
  HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
  LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAP
  CVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIM
  AKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
  ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
  KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVL
  GSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQ
  ITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL
  NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
  TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVE
  GEVRALLEQLGSSGS

• Sequence length: 975

Pathways

KEGG Pathway	Reactome Pathway
Mitophagy - animal	DDX58/IFIH1-mediated induction of interferon-alpha/beta
NOD-like receptor signaling pathway	Negative regulators of DDX58/IFIH1 signaling
RIG-I-like receptor signaling pathway
Influenza A

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Long QT syndrome	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (41)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31525189		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30802640		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30802640	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	29482578		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28960882	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29046236		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25938787		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26714018, 26971998, 28159898, 29535731		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26971998, 27452288		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36817485	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30861394		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30908533		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30908533		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30908533		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29046236		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30908533		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	29359232		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29535731, 31650868, 31694910		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31650868		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30908533		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28960882, 29482578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30802640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26971998		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26971998		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26971998, 27452288		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	29482578		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31525189		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26971998, 27105514, 27452288, 28960882, 29482578		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	29359232		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28240593		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30317623		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26876213	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26876213		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29514047		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24901306	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30802640		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DHX58 2 shared pathwaysRIG-I-like receptor signaling pathway, DDX58/IFIH1-mediated induction of interferon-alpha/beta Related via 2 shared pathways including RIG-I-like receptor signaling pathway, DDX58/IFIH1-mediated induction of interferon-alpha/beta. NLRC5 2 shared pathwaysNegative regulators of DDX58/IFIH1 signaling, DDX58/IFIH1-mediated induction of interferon-alpha/beta Related via 2 shared pathways including Negative regulators of DDX58/IFIH1 signaling, DDX58/IFIH1-mediated induction of interferon-alpha/beta. OTUD5 2 shared pathwaysRIG-I-like receptor signaling pathway, Negative regulators of DDX58/IFIH1 signaling Related via 2 shared pathways including RIG-I-like receptor signaling pathway, Negative regulators of DDX58/IFIH1 signaling. HERC5 2 shared pathwaysNegative regulators of DDX58/IFIH1 signaling, DDX58/IFIH1-mediated induction of interferon-alpha/beta Related via 2 shared pathways including Negative regulators of DDX58/IFIH1 signaling, DDX58/IFIH1-mediated induction of interferon-alpha/beta. MAVS 5 shared pathwaysNOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Influenza A, Negative regulators of DDX58/IFIH1 signaling, DDX58/IFIH1-mediated induction of interferon-alpha/beta Related via 5 shared pathways including NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DHX58	0	[]	2	["RIG-I-like receptor signaling pathway","DDX58\/IFIH1-mediated induction of interferon-alpha\/beta"]	0	[]
NLRC5	0	[]	2	["Negative regulators of DDX58\/IFIH1 signaling","DDX58\/IFIH1-mediated induction of interferon-alpha\/beta"]	0	[]
OTUD5	0	[]	2	["RIG-I-like receptor signaling pathway","Negative regulators of DDX58\/IFIH1 signaling"]	0	[]
HERC5	0	[]	2	["Negative regulators of DDX58\/IFIH1 signaling","DDX58\/IFIH1-mediated induction of interferon-alpha\/beta"]	0	[]
MAVS	0	[]	5	["NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Influenza A","Negative regulators of DDX58\/IFIH1 signaling","DDX58\/IFIH1-mediated induction of interferon-alpha\/beta"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesDHX58, MAVS Diabetes mellitus type 2 Linked via 2 of 5 related genesNLRC5, HERC5 Coronary artery disease Linked via 1 of 5 related genesDHX58 Bipolar disorder Linked via 1 of 5 related genesNLRC5 Fatty liver, alcoholic Linked via 1 of 5 related genesNLRC5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["DHX58","MAVS"]
Diabetes mellitus type 2	2	["NLRC5","HERC5"]
Coronary artery disease	1	["DHX58"]
Bipolar disorder	1	["NLRC5"]
Fatty liver, alcoholic	1	["NLRC5"]