Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4718
Gene name	NADH:ubiquinone oxidoreductase subunit C2
Gene symbol	NDUFC2
Synonyms (NCBI Gene)	B14.5bCI-B14.5bHLC-1MC1DN36NADHDH2
Chromosome	11
Chromosome location	11q14.1

396 Show/Hide all (396)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048415	hsa-miR-100-5p	CLASH	23622248
MIRT045857	hsa-miR-128-3p	CLASH	23622248
MIRT039104	hsa-miR-769-3p	CLASH	23622248
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	PAR-CLIP	26701625
MIRT623134	hsa-miR-1273g-3p	PAR-CLIP	26701625
MIRT623134	hsa-miR-1273g-3p	PAR-CLIP	26701625
MIRT623129	hsa-miR-4252	PAR-CLIP	26701625
MIRT623129	hsa-miR-4252	PAR-CLIP	26701625
MIRT623129	hsa-miR-4252	PAR-CLIP	26701625
MIRT623130	hsa-miR-4793-3p	PAR-CLIP	26701625
MIRT623130	hsa-miR-4793-3p	PAR-CLIP	26701625
MIRT623130	hsa-miR-4793-3p	PAR-CLIP	26701625
MIRT623136	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT623136	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT623136	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT623128	hsa-miR-6512-3p	PAR-CLIP	26701625
MIRT623128	hsa-miR-6512-3p	PAR-CLIP	26701625
MIRT623128	hsa-miR-6512-3p	PAR-CLIP	26701625
MIRT623127	hsa-miR-6720-5p	PAR-CLIP	26701625
MIRT623127	hsa-miR-6720-5p	PAR-CLIP	26701625
MIRT623127	hsa-miR-6720-5p	PAR-CLIP	26701625
MIRT623133	hsa-miR-6849-3p	PAR-CLIP	26701625
MIRT623133	hsa-miR-6849-3p	PAR-CLIP	26701625
MIRT623133	hsa-miR-6849-3p	PAR-CLIP	26701625
MIRT623132	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT623132	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT623132	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT623126	hsa-miR-7703	PAR-CLIP	26701625
MIRT623126	hsa-miR-7703	PAR-CLIP	26701625
MIRT623126	hsa-miR-7703	PAR-CLIP	26701625
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT623136	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT623135	hsa-miR-4293	HITS-CLIP	23824327
MIRT623134	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT623133	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT623132	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT623131	hsa-miR-4502	HITS-CLIP	23824327
MIRT623130	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT623129	hsa-miR-4252	HITS-CLIP	23824327
MIRT623128	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT623127	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT623126	hsa-miR-7703	HITS-CLIP	23824327
MIRT1179085	hsa-miR-1225-5p	CLIP-seq
MIRT1179086	hsa-miR-24	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179090	hsa-miR-324-5p	CLIP-seq
MIRT1179091	hsa-miR-34a	CLIP-seq
MIRT1179092	hsa-miR-34c-5p	CLIP-seq
MIRT1179093	hsa-miR-3665	CLIP-seq
MIRT1179094	hsa-miR-3672	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179096	hsa-miR-3714	CLIP-seq
MIRT1179097	hsa-miR-4284	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179099	hsa-miR-449a	CLIP-seq
MIRT1179100	hsa-miR-449b	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179103	hsa-miR-4640-5p	CLIP-seq
MIRT1179104	hsa-miR-4726-5p	CLIP-seq
MIRT1179105	hsa-miR-4736	CLIP-seq
MIRT1179106	hsa-miR-4753-5p	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT1179108	hsa-miR-1204	CLIP-seq
MIRT1179109	hsa-miR-1207-3p	CLIP-seq
MIRT1179110	hsa-miR-1268	CLIP-seq
MIRT1179111	hsa-miR-1268b	CLIP-seq
MIRT1179112	hsa-miR-1273e	CLIP-seq
MIRT1179113	hsa-miR-1827	CLIP-seq
MIRT1179114	hsa-miR-214	CLIP-seq
MIRT1179115	hsa-miR-2964a-3p	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT1179116	hsa-miR-335	CLIP-seq
MIRT1179117	hsa-miR-3619-5p	CLIP-seq
MIRT1179118	hsa-miR-3622b-5p	CLIP-seq
MIRT1179094	hsa-miR-3672	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179119	hsa-miR-3929	CLIP-seq
MIRT1179120	hsa-miR-3974	CLIP-seq
MIRT1179121	hsa-miR-4276	CLIP-seq
MIRT1179122	hsa-miR-4419b	CLIP-seq
MIRT1179123	hsa-miR-4440	CLIP-seq
MIRT1179124	hsa-miR-4457	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179126	hsa-miR-4461	CLIP-seq
MIRT1179127	hsa-miR-4478	CLIP-seq
MIRT1179128	hsa-miR-4486	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179129	hsa-miR-4649-3p	CLIP-seq
MIRT1179130	hsa-miR-4684-5p	CLIP-seq
MIRT1179131	hsa-miR-4722-5p	CLIP-seq
MIRT1179132	hsa-miR-4768-3p	CLIP-seq
MIRT1179133	hsa-miR-4786-5p	CLIP-seq
MIRT1179134	hsa-miR-485-5p	CLIP-seq
MIRT1179135	hsa-miR-513b	CLIP-seq
MIRT1179136	hsa-miR-548ac	CLIP-seq
MIRT1179137	hsa-miR-548ae	CLIP-seq
MIRT1179138	hsa-miR-548aj	CLIP-seq
MIRT1179139	hsa-miR-548am	CLIP-seq
MIRT1179140	hsa-miR-548c-3p	CLIP-seq
MIRT1179141	hsa-miR-548d-3p	CLIP-seq
MIRT1179142	hsa-miR-548x	CLIP-seq
MIRT1179143	hsa-miR-548z	CLIP-seq
MIRT1179144	hsa-miR-585	CLIP-seq
MIRT1179145	hsa-miR-624	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT1179147	hsa-miR-761	CLIP-seq
MIRT1179148	hsa-miR-769-5p	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179112	hsa-miR-1273e	CLIP-seq
MIRT1179113	hsa-miR-1827	CLIP-seq
MIRT1179115	hsa-miR-2964a-3p	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT2051768	hsa-miR-3545-3p	CLIP-seq
MIRT1179093	hsa-miR-3665	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179096	hsa-miR-3714	CLIP-seq
MIRT1179119	hsa-miR-3929	CLIP-seq
MIRT1179122	hsa-miR-4419b	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179127	hsa-miR-4478	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179129	hsa-miR-4649-3p	CLIP-seq
MIRT1179131	hsa-miR-4722-5p	CLIP-seq
MIRT1179105	hsa-miR-4736	CLIP-seq
MIRT2051769	hsa-miR-4738-3p	CLIP-seq
MIRT1179106	hsa-miR-4753-5p	CLIP-seq
MIRT1179132	hsa-miR-4768-3p	CLIP-seq
MIRT1179134	hsa-miR-485-5p	CLIP-seq
MIRT2051770	hsa-miR-576-5p	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT2280903	hsa-miR-1183	CLIP-seq
MIRT1179112	hsa-miR-1273e	CLIP-seq
MIRT1179113	hsa-miR-1827	CLIP-seq
MIRT2280904	hsa-miR-25	CLIP-seq
MIRT1179115	hsa-miR-2964a-3p	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT2280905	hsa-miR-32	CLIP-seq
MIRT1179116	hsa-miR-335	CLIP-seq
MIRT2280906	hsa-miR-363	CLIP-seq
MIRT1179093	hsa-miR-3665	CLIP-seq
MIRT2280907	hsa-miR-367	CLIP-seq
MIRT1179094	hsa-miR-3672	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179096	hsa-miR-3714	CLIP-seq
MIRT1179120	hsa-miR-3974	CLIP-seq
MIRT2280908	hsa-miR-3977	CLIP-seq
MIRT1179121	hsa-miR-4276	CLIP-seq
MIRT1179124	hsa-miR-4457	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179126	hsa-miR-4461	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT2280909	hsa-miR-4709-3p	CLIP-seq
MIRT1179131	hsa-miR-4722-5p	CLIP-seq
MIRT2280910	hsa-miR-4735-5p	CLIP-seq
MIRT1179105	hsa-miR-4736	CLIP-seq
MIRT2051769	hsa-miR-4738-3p	CLIP-seq
MIRT1179132	hsa-miR-4768-3p	CLIP-seq
MIRT1179133	hsa-miR-4786-5p	CLIP-seq
MIRT2280911	hsa-miR-4799-5p	CLIP-seq
MIRT1179135	hsa-miR-513b	CLIP-seq
MIRT2051770	hsa-miR-576-5p	CLIP-seq
MIRT1179145	hsa-miR-624	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT2280912	hsa-miR-766	CLIP-seq
MIRT2280913	hsa-miR-767-5p	CLIP-seq
MIRT1179148	hsa-miR-769-5p	CLIP-seq
MIRT2280914	hsa-miR-92a	CLIP-seq
MIRT2280915	hsa-miR-92b	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179106	hsa-miR-4753-5p	CLIP-seq
MIRT1179112	hsa-miR-1273e	CLIP-seq
MIRT1179113	hsa-miR-1827	CLIP-seq
MIRT1179115	hsa-miR-2964a-3p	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179131	hsa-miR-4722-5p	CLIP-seq
MIRT1179132	hsa-miR-4768-3p	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT2051769	hsa-miR-4738-3p	CLIP-seq
MIRT1179108	hsa-miR-1204	CLIP-seq
MIRT1179109	hsa-miR-1207-3p	CLIP-seq
MIRT1179110	hsa-miR-1268	CLIP-seq
MIRT1179111	hsa-miR-1268b	CLIP-seq
MIRT2579340	hsa-miR-2114	CLIP-seq
MIRT1179114	hsa-miR-214	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT2579341	hsa-miR-3149	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179090	hsa-miR-324-5p	CLIP-seq
MIRT1179117	hsa-miR-3619-5p	CLIP-seq
MIRT1179118	hsa-miR-3622b-5p	CLIP-seq
MIRT1179093	hsa-miR-3665	CLIP-seq
MIRT2579342	hsa-miR-3668	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179096	hsa-miR-3714	CLIP-seq
MIRT2579343	hsa-miR-3924	CLIP-seq
MIRT2579344	hsa-miR-4437	CLIP-seq
MIRT1179123	hsa-miR-4440	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179128	hsa-miR-4486	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179130	hsa-miR-4684-5p	CLIP-seq
MIRT2579345	hsa-miR-4685-5p	CLIP-seq
MIRT2579346	hsa-miR-4732-5p	CLIP-seq
MIRT2280910	hsa-miR-4735-5p	CLIP-seq
MIRT1179105	hsa-miR-4736	CLIP-seq
MIRT1179106	hsa-miR-4753-5p	CLIP-seq
MIRT2579347	hsa-miR-4775	CLIP-seq
MIRT2579348	hsa-miR-494	CLIP-seq
MIRT2579349	hsa-miR-501-3p	CLIP-seq
MIRT2579350	hsa-miR-502-3p	CLIP-seq
MIRT1179136	hsa-miR-548ac	CLIP-seq
MIRT1179137	hsa-miR-548ae	CLIP-seq
MIRT1179138	hsa-miR-548aj	CLIP-seq
MIRT1179139	hsa-miR-548am	CLIP-seq
MIRT1179140	hsa-miR-548c-3p	CLIP-seq
MIRT1179141	hsa-miR-548d-3p	CLIP-seq
MIRT1179142	hsa-miR-548x	CLIP-seq
MIRT1179143	hsa-miR-548z	CLIP-seq
MIRT1179144	hsa-miR-585	CLIP-seq
MIRT2579351	hsa-miR-590-3p	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT1179147	hsa-miR-761	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq
MIRT2051769	hsa-miR-4738-3p	CLIP-seq
MIRT2686100	hsa-miR-106a	CLIP-seq
MIRT2686101	hsa-miR-106b	CLIP-seq
MIRT1179108	hsa-miR-1204	CLIP-seq
MIRT1179109	hsa-miR-1207-3p	CLIP-seq
MIRT2686102	hsa-miR-1224-3p	CLIP-seq
MIRT2686103	hsa-miR-1227	CLIP-seq
MIRT2686104	hsa-miR-1260	CLIP-seq
MIRT2686105	hsa-miR-1260b	CLIP-seq
MIRT1179110	hsa-miR-1268	CLIP-seq
MIRT1179111	hsa-miR-1268b	CLIP-seq
MIRT1179112	hsa-miR-1273e	CLIP-seq
MIRT2686106	hsa-miR-1280	CLIP-seq
MIRT2686107	hsa-miR-17	CLIP-seq
MIRT1179113	hsa-miR-1827	CLIP-seq
MIRT2686108	hsa-miR-197	CLIP-seq
MIRT2686109	hsa-miR-20a	CLIP-seq
MIRT2686110	hsa-miR-20b	CLIP-seq
MIRT2579340	hsa-miR-2114	CLIP-seq
MIRT1179114	hsa-miR-214	CLIP-seq
MIRT1179115	hsa-miR-2964a-3p	CLIP-seq
MIRT2686111	hsa-miR-302a	CLIP-seq
MIRT2686112	hsa-miR-302b	CLIP-seq
MIRT2686113	hsa-miR-302c	CLIP-seq
MIRT2686114	hsa-miR-302d	CLIP-seq
MIRT2686115	hsa-miR-302e	CLIP-seq
MIRT1179087	hsa-miR-302f	CLIP-seq
MIRT2579341	hsa-miR-3149	CLIP-seq
MIRT1179088	hsa-miR-3165	CLIP-seq
MIRT1179089	hsa-miR-3202	CLIP-seq
MIRT1179090	hsa-miR-324-5p	CLIP-seq
MIRT1179117	hsa-miR-3619-5p	CLIP-seq
MIRT1179118	hsa-miR-3622b-5p	CLIP-seq
MIRT1179093	hsa-miR-3665	CLIP-seq
MIRT2579342	hsa-miR-3668	CLIP-seq
MIRT1179095	hsa-miR-3689d	CLIP-seq
MIRT1179096	hsa-miR-3714	CLIP-seq
MIRT2686116	hsa-miR-372	CLIP-seq
MIRT2686117	hsa-miR-373	CLIP-seq
MIRT2579343	hsa-miR-3924	CLIP-seq
MIRT1179119	hsa-miR-3929	CLIP-seq
MIRT2686118	hsa-miR-3973	CLIP-seq
MIRT1179121	hsa-miR-4276	CLIP-seq
MIRT1179122	hsa-miR-4419b	CLIP-seq
MIRT2579344	hsa-miR-4437	CLIP-seq
MIRT1179123	hsa-miR-4440	CLIP-seq
MIRT1179125	hsa-miR-4459	CLIP-seq
MIRT1179127	hsa-miR-4478	CLIP-seq
MIRT1179128	hsa-miR-4486	CLIP-seq
MIRT1179098	hsa-miR-4493	CLIP-seq
MIRT1179101	hsa-miR-4533	CLIP-seq
MIRT1179102	hsa-miR-4537	CLIP-seq
MIRT1179129	hsa-miR-4649-3p	CLIP-seq
MIRT1179130	hsa-miR-4684-5p	CLIP-seq
MIRT2579345	hsa-miR-4685-5p	CLIP-seq
MIRT2686119	hsa-miR-4715-3p	CLIP-seq
MIRT1179131	hsa-miR-4722-5p	CLIP-seq
MIRT2686120	hsa-miR-4731-5p	CLIP-seq
MIRT2579346	hsa-miR-4732-5p	CLIP-seq
MIRT2280910	hsa-miR-4735-5p	CLIP-seq
MIRT1179105	hsa-miR-4736	CLIP-seq
MIRT1179106	hsa-miR-4753-5p	CLIP-seq
MIRT1179132	hsa-miR-4768-3p	CLIP-seq
MIRT2579347	hsa-miR-4775	CLIP-seq
MIRT1179134	hsa-miR-485-5p	CLIP-seq
MIRT2579348	hsa-miR-494	CLIP-seq
MIRT2579349	hsa-miR-501-3p	CLIP-seq
MIRT2579350	hsa-miR-502-3p	CLIP-seq
MIRT2686121	hsa-miR-5096	CLIP-seq
MIRT2686122	hsa-miR-512-3p	CLIP-seq
MIRT2686123	hsa-miR-519d	CLIP-seq
MIRT2686124	hsa-miR-520a-3p	CLIP-seq
MIRT2686125	hsa-miR-520b	CLIP-seq
MIRT2686126	hsa-miR-520c-3p	CLIP-seq
MIRT2686127	hsa-miR-520d-3p	CLIP-seq
MIRT2686128	hsa-miR-520e	CLIP-seq
MIRT2686129	hsa-miR-520g	CLIP-seq
MIRT2686130	hsa-miR-520h	CLIP-seq
MIRT2686131	hsa-miR-532-3p	CLIP-seq
MIRT1179136	hsa-miR-548ac	CLIP-seq
MIRT1179137	hsa-miR-548ae	CLIP-seq
MIRT1179138	hsa-miR-548aj	CLIP-seq
MIRT1179139	hsa-miR-548am	CLIP-seq
MIRT1179140	hsa-miR-548c-3p	CLIP-seq
MIRT1179141	hsa-miR-548d-3p	CLIP-seq
MIRT1179142	hsa-miR-548x	CLIP-seq
MIRT1179143	hsa-miR-548z	CLIP-seq
MIRT1179144	hsa-miR-585	CLIP-seq
MIRT2579351	hsa-miR-590-3p	CLIP-seq
MIRT1179146	hsa-miR-665	CLIP-seq
MIRT1179147	hsa-miR-761	CLIP-seq
MIRT2686132	hsa-miR-93	CLIP-seq
MIRT1179107	hsa-miR-940	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32320651, 33753518
GO:0005737	Component	Cytoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IEA
GO:0016020	Component	Membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	32969598
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IEA

MIM	HGNC	e!Ensembl
603845	7706	ENSG00000151366

O95298

Protein name

NADH dehydrogenase [ubiquinone] 1 subunit C2 (Complex I-B14.5b) (CI-B14.5b) (Human lung cancer oncogene 1 protein) (HLC-1) (NADH-ubiquinone oxidoreductase subunit B14.5b)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis but required for the complex assembly. Complex I functions in the transfer of electrons from NADH

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06374	NDUF_C2	10 → 119	NADH-ubiquinone oxidoreductase subunit b14.5b (NDUFC2)	Family

Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

Sequence length

119

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Oxidative phosphorylation	Respiratory electron transport
Metabolic pathways	Neutrophil degranulation
Thermogenesis	Complex I biogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Mitochondrial complex I deficiency, nuclear type 36	Pathogenic	rs1858924087, rs1859088426	RCV001290294 RCV001290295	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial disease	Pathogenic	rs1858924087, rs1859088426	RCV001251449 RCV001251448	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LEIGH SYNDROME	—	ClinGen, GenCC	27509854, 27626371, 32969598	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet, ClinGen	ClinGen report	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30808603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24065141, 29434849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17925008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26888427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	3390172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25804238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23028138, 25245408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26888427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	32969598, 33124751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	33124751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39754905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24065141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	30808603		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NDUFA9	3	["Leigh syndrome","Mitochondrial complex deficiency","Mitochondrial disease"]	10	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	5	["ClinGen (Leigh syndrome)","ClinVar (Mitochondrial complex deficiency)","Disgenet (Mitochondrial complex deficiency)","HPO (Mitochondrial complex deficiency)","ClinGen (Mitochondrial disease)"]
NDUFS7	3	["Leigh syndrome","Mitochondrial complex deficiency","Mitochondrial disease"]	10	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	6	["ClinGen (Leigh syndrome)","ClinVar (Mitochondrial complex deficiency)","Disgenet (Mitochondrial complex deficiency)","HPO (Mitochondrial complex deficiency)","ClinGen (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]
UQCRQ	3	["Leigh syndrome","Mitochondrial complex deficiency","Mitochondrial disease"]	8	["Oxidative phosphorylation","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport"]	6	["ClinGen (Leigh syndrome)","ClinVar (Mitochondrial complex deficiency)","Disgenet (Mitochondrial complex deficiency)","HPO (Mitochondrial complex deficiency)","CTD (Mitochondrial complex deficiency)","ClinGen (Mitochondrial disease)"]
NDUFA1	3	["Leigh syndrome","Mitochondrial complex deficiency","Mitochondrial disease"]	10	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	5	["ClinGen (Leigh syndrome)","ClinVar (Mitochondrial complex deficiency)","Disgenet (Mitochondrial complex deficiency)","HPO (Mitochondrial complex deficiency)","ClinGen (Mitochondrial disease)"]
NDUFS8	3	["Leigh syndrome","Mitochondrial complex deficiency","Mitochondrial disease"]	10	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	6	["ClinGen (Leigh syndrome)","ClinVar (Mitochondrial complex deficiency)","Disgenet (Mitochondrial complex deficiency)","HPO (Mitochondrial complex deficiency)","ClinGen (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]

NDUFC2 (NADH:ubiquinone oxidoreductase subunit C2)

Bookmark This Gene