NCBP2L (nuclear cap binding protein subunit 2 like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 392517
Gene name Nuclear cap binding protein subunit 2 like
Gene symbol NCBP2L
Synonyms (NCBI Gene)
dJ820B18.1
Chromosome X
Chromosome location Xq22.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000339 Function RNA cap binding IBA
GO:0000339 Function RNA cap binding IEA
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6PVI3
Protein name Nuclear cap-binding protein subunit 2-like
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 41 → 106 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence 
MSKDLKILCKDPALELSCYRDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFS
RSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLTGTCLDEWIICTDWDVGFREG
QQYGRGKSGGQVRDEFREDFHSGRGGFGRQTQI
Sequence length 153
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Nucleocytoplasmic transport
mRNA surveillance pathway
Spliceosome
Sort by:
ACIN1 3 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway, Spliceosome Related via 3 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway. DDX19B 2 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway Related via 2 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway. PNN 2 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway Related via 2 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway. DDX19A 2 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway Related via 2 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway. PYM1 2 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway Related via 2 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway.
Breast cancer Linked via 1 of 5 related genesACIN1 Scoliosis Linked via 1 of 5 related genesACIN1 Gout Linked via 1 of 5 related genesDDX19B Insomnia Linked via 1 of 5 related genesPNN Alzheimer disease Linked via 1 of 5 related genesPYM1