NADK (NAD kinase)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 65220
• Gene name: NAD kinase
• Gene symbol: NADK
• Synonyms (NCBI Gene): NADK1, dJ283E3.1
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: NADK catalyzes the transfer of a phosphate group from ATP to NAD to generate NADP, which in its reduced form acts as an electron donor for biosynthetic reactions (Lerner et al., 2001 [PubMed 11594753]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049675	hsa-miR-92a-3p	CLASH	23622248
MIRT039348	hsa-miR-425-5p	CLASH	23622248
MIRT1172899	hsa-miR-1224-5p	CLIP-seq
MIRT1172900	hsa-miR-125a-5p	CLIP-seq
MIRT1172901	hsa-miR-125b	CLIP-seq
MIRT1172902	hsa-miR-2277-3p	CLIP-seq
MIRT1172903	hsa-miR-3148	CLIP-seq
MIRT1172904	hsa-miR-3622b-5p	CLIP-seq
MIRT1172905	hsa-miR-3688-3p	CLIP-seq
MIRT1172906	hsa-miR-4281	CLIP-seq
MIRT1172907	hsa-miR-4319	CLIP-seq
MIRT1172908	hsa-miR-4720-5p	CLIP-seq
MIRT1172909	hsa-miR-4732-3p	CLIP-seq
MIRT1172910	hsa-miR-4751	CLIP-seq
MIRT1172911	hsa-miR-4754	CLIP-seq
MIRT1172912	hsa-miR-4799-3p	CLIP-seq
MIRT1172913	hsa-miR-544b	CLIP-seq
MIRT1172914	hsa-miR-670	CLIP-seq
MIRT738803	hsa-miR-1914	CLIP-seq
MIRT738804	hsa-miR-331-3p	CLIP-seq
MIRT738805	hsa-miR-378g	CLIP-seq
MIRT738806	hsa-miR-4505	CLIP-seq
MIRT738803	hsa-miR-1914	CLIP-seq
MIRT738804	hsa-miR-331-3p	CLIP-seq
MIRT738805	hsa-miR-378g	CLIP-seq
MIRT738806	hsa-miR-4505	CLIP-seq
MIRT2050079	hsa-miR-1202	CLIP-seq
MIRT1172900	hsa-miR-125a-5p	CLIP-seq
MIRT1172901	hsa-miR-125b	CLIP-seq
MIRT2050080	hsa-miR-148a	CLIP-seq
MIRT2050081	hsa-miR-148b	CLIP-seq
MIRT2050082	hsa-miR-152	CLIP-seq
MIRT2050083	hsa-miR-298	CLIP-seq
MIRT2050084	hsa-miR-3065-3p	CLIP-seq
MIRT2050085	hsa-miR-3176	CLIP-seq
MIRT2050086	hsa-miR-3194-5p	CLIP-seq
MIRT2050087	hsa-miR-3667-3p	CLIP-seq
MIRT2050088	hsa-miR-3922-3p	CLIP-seq
MIRT2050089	hsa-miR-3943	CLIP-seq
MIRT2050090	hsa-miR-3972	CLIP-seq
MIRT2050091	hsa-miR-4252	CLIP-seq
MIRT1172906	hsa-miR-4281	CLIP-seq
MIRT1172907	hsa-miR-4319	CLIP-seq
MIRT2050092	hsa-miR-4691-3p	CLIP-seq
MIRT1172909	hsa-miR-4732-3p	CLIP-seq
MIRT2050093	hsa-miR-4757-5p	CLIP-seq
MIRT2050094	hsa-miR-4790-3p	CLIP-seq
MIRT2050095	hsa-miR-4795-5p	CLIP-seq
MIRT2050096	hsa-miR-499-3p	CLIP-seq
MIRT2050097	hsa-miR-499a-3p	CLIP-seq
MIRT2050098	hsa-miR-512-3p	CLIP-seq
MIRT1172913	hsa-miR-544b	CLIP-seq
MIRT2050099	hsa-miR-548l	CLIP-seq
MIRT2050100	hsa-miR-548v	CLIP-seq
MIRT2050101	hsa-miR-561	CLIP-seq
MIRT1172914	hsa-miR-670	CLIP-seq
MIRT2278911	hsa-miR-412	CLIP-seq
MIRT2050099	hsa-miR-548l	CLIP-seq
MIRT2577162	hsa-miR-1266	CLIP-seq
MIRT2577163	hsa-miR-4518	CLIP-seq
MIRT2577164	hsa-miR-4520b-3p	CLIP-seq
MIRT2577165	hsa-miR-4529-3p	CLIP-seq
MIRT2577166	hsa-miR-4663	CLIP-seq
MIRT2577167	hsa-miR-4728-3p	CLIP-seq
MIRT2577168	hsa-miR-4804-5p	CLIP-seq
MIRT2577169	hsa-miR-510	CLIP-seq
MIRT2577170	hsa-miR-574-3p	CLIP-seq
MIRT2685732	hsa-miR-1207-3p	CLIP-seq
MIRT2577162	hsa-miR-1266	CLIP-seq
MIRT2685733	hsa-miR-3135b	CLIP-seq
MIRT2685734	hsa-miR-3612	CLIP-seq
MIRT2685735	hsa-miR-4443	CLIP-seq
MIRT2577163	hsa-miR-4518	CLIP-seq
MIRT2577164	hsa-miR-4520b-3p	CLIP-seq
MIRT2577165	hsa-miR-4529-3p	CLIP-seq
MIRT2577168	hsa-miR-4804-5p	CLIP-seq
MIRT2577169	hsa-miR-510	CLIP-seq
MIRT2577170	hsa-miR-574-3p	CLIP-seq
MIRT2685736	hsa-miR-650	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003951	Function	NAD+ kinase activity	IBA
GO:0003951	Function	NAD+ kinase activity	IDA	11594753
GO:0003951	Function	NAD+ kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15161933, 16189514, 25416956, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	11594753
GO:0006741	Process	NADP+ biosynthetic process	IBA
GO:0006741	Process	NADP+ biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	NAS	11594753
GO:0016740	Function	Transferase activity	IEA
GO:0019674	Process	NAD+ metabolic process	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0046034	Process	ATP metabolic process	NAS	11594753
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 611616
• HGNC: 29831
• e!Ensembl: ENSG00000008130

Protein

• UniProt ID: O95544
• Protein name: NAD kinase (EC 2.7.1.23) (Poly(P)/ATP NAD kinase)
• PDB: 3PFN , 8KGC , 9CR3 , 9CR4 , 9CRA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01513	NAD_kinase	106 → 410	ATP-NAD kinase	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed but not detected in skeletal muscle. {ECO:0000269|PubMed:11594753}.
• Sequence:

  MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFR
  RTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQ
  PFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIIC
  LGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRL
  KVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVD
  VYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVV
  PAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES
  LAQCLHWNVRKKQAHFEEEEEEEEEG

• Sequence length: 446

Pathways

KEGG Pathway	Reactome Pathway
Nicotinate and nicotinamide metabolism	Nicotinate metabolism
Metabolic pathways
Biosynthesis of cofactors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26806015		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36841051	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37416767	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25877407	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34588774	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NADK2 3 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors, Nicotinate metabolism Related via 3 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NMNAT2 3 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors, Nicotinate metabolism Related via 3 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. QPRT 3 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors, Nicotinate metabolism Related via 3 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NMNAT3 3 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors, Nicotinate metabolism Related via 3 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NADSYN1 3 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors, Nicotinate metabolism Related via 3 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NADK2	0	[]	3	["Nicotinate and nicotinamide metabolism","Biosynthesis of cofactors","Nicotinate metabolism"]	0	[]
NMNAT2	0	[]	3	["Nicotinate and nicotinamide metabolism","Biosynthesis of cofactors","Nicotinate metabolism"]	0	[]
QPRT	0	[]	3	["Nicotinate and nicotinamide metabolism","Biosynthesis of cofactors","Nicotinate metabolism"]	0	[]
NMNAT3	0	[]	3	["Nicotinate and nicotinamide metabolism","Biosynthesis of cofactors","Nicotinate metabolism"]	0	[]
NADSYN1	0	[]	3	["Nicotinate and nicotinamide metabolism","Biosynthesis of cofactors","Nicotinate metabolism"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesNADK2, NMNAT2 Systemic lupus erythematosus Linked via 2 of 5 related genesNMNAT2, NADSYN1 2,4-dienoyl-coa reductase deficiency Linked via 1 of 5 related genesNADK2 Multinodular goiter Linked via 1 of 5 related genesNADK2 progressive encephalopathy with leukodystrophy due to DECR deficiency Linked via 1 of 5 related genesNADK2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["NADK2","NMNAT2"]
Systemic lupus erythematosus	2	["NMNAT2","NADSYN1"]
2,4-dienoyl-coa reductase deficiency	1	["NADK2"]
Multinodular goiter	1	["NADK2"]
progressive encephalopathy with leukodystrophy due to DECR deficiency	1	["NADK2"]