MORN1 (MORN repeat containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79906
Gene name MORN repeat containing 1
Gene symbol MORN1
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p36.32
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T089
Protein name MORN repeat-containing protein 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02493 MORN 39 → 61 MORN repeat Repeat
PF02493 MORN 155 → 177 MORN repeat Repeat
PF02493 MORN 132 → 154 MORN repeat Repeat
PF02493 MORN 109 → 131 MORN repeat Repeat
PF02493 MORN 86 → 108 MORN repeat Repeat
PF02493 MORN 62 → 83 MORN repeat Repeat
PF02493 MORN 23 → 35 MORN repeat Repeat
PF02493 MORN 178 → 200 MORN repeat Repeat
Sequence 
MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGS
YYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREG
HGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKG
QWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLL
QDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPFGFECIPYPVS
SPAAGVPGPRAAKGGAEADVPLPRGDLELHLGALHGQEDTPGGLLARGHAPHCPGACQRV
EQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGRSRGGLHPRGTPPTAQEPPGGSRPEG
RATEEQAAAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRVVAKRAGQPPHVLEEGPEAS
SSWQAAHSCTPEPPAPR
Sequence length 497
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (6)
Phenotype Name Clinical Significance Source Reference Evidence Score
CORONARY ARTERY DISEASE — GWAS catalog 29212778, 36474045
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Melanoma Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION — GWAS catalog 33532862
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS — GWAS catalog 40205036
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME — CTD, Disgenet
CTD, Disgenet 		21411543
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Polycystic Ovary Syndrome Polycystic Ovary Syndrome CTD_human_DG 21411543
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sacral defect and anterior sacral meningocele Sacral defect Pubtator 28007035 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sclerocystic Ovaries Sclerocystic Ovaries CTD_human_DG 21411543
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
ARHGAP30 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. CARMIL3 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. DACT3 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. DCBLD2 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. ELAVL3 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD.
Intellectual developmental disorder Linked via 1 of 5 related genesDACT3 Stomach neoplasms Linked via 1 of 5 related genesDCBLD2 Alzheimer disease Linked via 1 of 5 related genesELAVL3 Oligodendroglioma Linked via 1 of 5 related genesELAVL3