Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	196074
Gene name	Methyltransferase 15, mitochondrial 12S rRNA N4-cytidine
Gene symbol	METTL15
Synonyms (NCBI Gene)	METT5D1
Chromosome	11
Chromosome location	11p14.1

243 Show/Hide all (243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT718016	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT718015	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT718014	hsa-miR-4267	HITS-CLIP	19536157
MIRT718013	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT718012	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718011	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT718010	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT718009	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT718008	hsa-miR-6516-3p	HITS-CLIP	19536157
MIRT718007	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT718006	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT710459	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT710458	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT710457	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT710456	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710455	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT710454	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT710453	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT710452	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT718016	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT718015	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT718014	hsa-miR-4267	HITS-CLIP	19536157
MIRT718013	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT718012	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718011	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT718010	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT718009	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT718008	hsa-miR-6516-3p	HITS-CLIP	19536157
MIRT718007	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT718006	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT710459	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT710458	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT710457	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT710456	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710455	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT710454	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT710453	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT710452	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT1143860	hsa-miR-1267	CLIP-seq
MIRT1143861	hsa-miR-129-5p	CLIP-seq
MIRT1143862	hsa-miR-181a	CLIP-seq
MIRT1143863	hsa-miR-181b	CLIP-seq
MIRT1143864	hsa-miR-181c	CLIP-seq
MIRT1143865	hsa-miR-181d	CLIP-seq
MIRT1143866	hsa-miR-182	CLIP-seq
MIRT1143867	hsa-miR-296-3p	CLIP-seq
MIRT1143868	hsa-miR-3659	CLIP-seq
MIRT1143869	hsa-miR-3672	CLIP-seq
MIRT1143870	hsa-miR-4262	CLIP-seq
MIRT1143871	hsa-miR-4524	CLIP-seq
MIRT1143872	hsa-miR-4652-3p	CLIP-seq
MIRT1143873	hsa-miR-4658	CLIP-seq
MIRT1143874	hsa-miR-4690-5p	CLIP-seq
MIRT1143875	hsa-miR-4716-5p	CLIP-seq
MIRT1143876	hsa-miR-4768-5p	CLIP-seq
MIRT1143877	hsa-miR-4797-5p	CLIP-seq
MIRT1143878	hsa-miR-574-5p	CLIP-seq
MIRT1143879	hsa-miR-656	CLIP-seq
MIRT1143880	hsa-miR-922	CLIP-seq
MIRT1143881	hsa-miR-125a-5p	CLIP-seq
MIRT1143882	hsa-miR-125b	CLIP-seq
MIRT1143883	hsa-miR-1272	CLIP-seq
MIRT1143884	hsa-miR-1322	CLIP-seq
MIRT1143885	hsa-miR-145	CLIP-seq
MIRT1143886	hsa-miR-3143	CLIP-seq
MIRT1143887	hsa-miR-3180-5p	CLIP-seq
MIRT1143888	hsa-miR-323b-3p	CLIP-seq
MIRT1143889	hsa-miR-335	CLIP-seq
MIRT1143868	hsa-miR-3659	CLIP-seq
MIRT1143890	hsa-miR-4297	CLIP-seq
MIRT1143891	hsa-miR-4319	CLIP-seq
MIRT1143892	hsa-miR-4457	CLIP-seq
MIRT1143893	hsa-miR-4517	CLIP-seq
MIRT1143873	hsa-miR-4658	CLIP-seq
MIRT1143894	hsa-miR-4732-3p	CLIP-seq
MIRT1143876	hsa-miR-4768-5p	CLIP-seq
MIRT1143895	hsa-miR-4803	CLIP-seq
MIRT1143896	hsa-miR-513b	CLIP-seq
MIRT1143897	hsa-miR-518a-5p	CLIP-seq
MIRT1143898	hsa-miR-527	CLIP-seq
MIRT1143899	hsa-miR-539	CLIP-seq
MIRT1143878	hsa-miR-574-5p	CLIP-seq
MIRT1143900	hsa-miR-622	CLIP-seq
MIRT1143901	hsa-miR-670	CLIP-seq
MIRT1143902	hsa-miR-944	CLIP-seq
MIRT1143860	hsa-miR-1267	CLIP-seq
MIRT1143872	hsa-miR-4652-3p	CLIP-seq
MIRT2040927	hsa-miR-633	CLIP-seq
MIRT2270572	hsa-miR-106a	CLIP-seq
MIRT2270573	hsa-miR-106b	CLIP-seq
MIRT2270574	hsa-miR-1229	CLIP-seq
MIRT2270575	hsa-miR-17	CLIP-seq
MIRT1143862	hsa-miR-181a	CLIP-seq
MIRT1143863	hsa-miR-181b	CLIP-seq
MIRT1143864	hsa-miR-181c	CLIP-seq
MIRT1143865	hsa-miR-181d	CLIP-seq
MIRT2270576	hsa-miR-20a	CLIP-seq
MIRT2270577	hsa-miR-20b	CLIP-seq
MIRT2270578	hsa-miR-3159	CLIP-seq
MIRT1143870	hsa-miR-4262	CLIP-seq
MIRT1143871	hsa-miR-4524	CLIP-seq
MIRT2270579	hsa-miR-4649-3p	CLIP-seq
MIRT1143874	hsa-miR-4690-5p	CLIP-seq
MIRT1143875	hsa-miR-4716-5p	CLIP-seq
MIRT2270580	hsa-miR-496	CLIP-seq
MIRT2270581	hsa-miR-519a	CLIP-seq
MIRT2270582	hsa-miR-519b-3p	CLIP-seq
MIRT2270583	hsa-miR-519c-3p	CLIP-seq
MIRT2270584	hsa-miR-519d	CLIP-seq
MIRT2270585	hsa-miR-548aa	CLIP-seq
MIRT2270586	hsa-miR-548t	CLIP-seq
MIRT2040927	hsa-miR-633	CLIP-seq
MIRT2270587	hsa-miR-759	CLIP-seq
MIRT1143880	hsa-miR-922	CLIP-seq
MIRT2270588	hsa-miR-93	CLIP-seq
MIRT1143860	hsa-miR-1267	CLIP-seq
MIRT1143869	hsa-miR-3672	CLIP-seq
MIRT1143872	hsa-miR-4652-3p	CLIP-seq
MIRT1143877	hsa-miR-4797-5p	CLIP-seq
MIRT2569750	hsa-miR-1197	CLIP-seq
MIRT1143881	hsa-miR-125a-5p	CLIP-seq
MIRT1143882	hsa-miR-125b	CLIP-seq
MIRT2569751	hsa-miR-1273f	CLIP-seq
MIRT2569752	hsa-miR-139-5p	CLIP-seq
MIRT1143885	hsa-miR-145	CLIP-seq
MIRT1143862	hsa-miR-181a	CLIP-seq
MIRT1143863	hsa-miR-181b	CLIP-seq
MIRT1143864	hsa-miR-181c	CLIP-seq
MIRT1143865	hsa-miR-181d	CLIP-seq
MIRT2569753	hsa-miR-188-3p	CLIP-seq
MIRT2569754	hsa-miR-1915	CLIP-seq
MIRT2569755	hsa-miR-29a	CLIP-seq
MIRT2569756	hsa-miR-29b	CLIP-seq
MIRT2569757	hsa-miR-29c	CLIP-seq
MIRT2569758	hsa-miR-3117-3p	CLIP-seq
MIRT2569759	hsa-miR-3127-5p	CLIP-seq
MIRT1143887	hsa-miR-3180-5p	CLIP-seq
MIRT2569760	hsa-miR-3187-3p	CLIP-seq
MIRT2569761	hsa-miR-323-3p	CLIP-seq
MIRT2569762	hsa-miR-3545-3p	CLIP-seq
MIRT2569763	hsa-miR-3617	CLIP-seq
MIRT1143868	hsa-miR-3659	CLIP-seq
MIRT2569764	hsa-miR-3663-5p	CLIP-seq
MIRT2569765	hsa-miR-3673	CLIP-seq
MIRT2569766	hsa-miR-3685	CLIP-seq
MIRT2569767	hsa-miR-3689d	CLIP-seq
MIRT2569768	hsa-miR-384	CLIP-seq
MIRT2569769	hsa-miR-411	CLIP-seq
MIRT1143870	hsa-miR-4262	CLIP-seq
MIRT2569770	hsa-miR-4270	CLIP-seq
MIRT2569771	hsa-miR-4282	CLIP-seq
MIRT1143891	hsa-miR-4319	CLIP-seq
MIRT2569772	hsa-miR-4435	CLIP-seq
MIRT2569773	hsa-miR-4441	CLIP-seq
MIRT2569774	hsa-miR-4444	CLIP-seq
MIRT2569775	hsa-miR-4453	CLIP-seq
MIRT2569776	hsa-miR-4538	CLIP-seq
MIRT2569777	hsa-miR-4635	CLIP-seq
MIRT1143873	hsa-miR-4658	CLIP-seq
MIRT2569778	hsa-miR-4680-5p	CLIP-seq
MIRT2569779	hsa-miR-4698	CLIP-seq
MIRT2569780	hsa-miR-4701-5p	CLIP-seq
MIRT1143875	hsa-miR-4716-5p	CLIP-seq
MIRT2569781	hsa-miR-4726-3p	CLIP-seq
MIRT1143894	hsa-miR-4732-3p	CLIP-seq
MIRT2569782	hsa-miR-4755-3p	CLIP-seq
MIRT2569783	hsa-miR-4765	CLIP-seq
MIRT1143876	hsa-miR-4768-5p	CLIP-seq
MIRT2569784	hsa-miR-4775	CLIP-seq
MIRT2569785	hsa-miR-4781-3p	CLIP-seq
MIRT2569786	hsa-miR-4799-5p	CLIP-seq
MIRT1143895	hsa-miR-4803	CLIP-seq
MIRT2569787	hsa-miR-516b	CLIP-seq
MIRT1143899	hsa-miR-539	CLIP-seq
MIRT2569788	hsa-miR-548s	CLIP-seq
MIRT1143878	hsa-miR-574-5p	CLIP-seq
MIRT2569789	hsa-miR-582-5p	CLIP-seq
MIRT2569790	hsa-miR-588	CLIP-seq
MIRT2569791	hsa-miR-590-3p	CLIP-seq
MIRT1143900	hsa-miR-622	CLIP-seq
MIRT2569792	hsa-miR-629	CLIP-seq
MIRT2569793	hsa-miR-641	CLIP-seq
MIRT2569794	hsa-miR-651	CLIP-seq
MIRT1143901	hsa-miR-670	CLIP-seq
MIRT2569795	hsa-miR-9	CLIP-seq
MIRT2569750	hsa-miR-1197	CLIP-seq
MIRT1143881	hsa-miR-125a-5p	CLIP-seq
MIRT1143882	hsa-miR-125b	CLIP-seq
MIRT2569751	hsa-miR-1273f	CLIP-seq
MIRT1143885	hsa-miR-145	CLIP-seq
MIRT2569754	hsa-miR-1915	CLIP-seq
MIRT2569755	hsa-miR-29a	CLIP-seq
MIRT2569756	hsa-miR-29b	CLIP-seq
MIRT2569757	hsa-miR-29c	CLIP-seq
MIRT2569758	hsa-miR-3117-3p	CLIP-seq
MIRT2684841	hsa-miR-3126-5p	CLIP-seq
MIRT2684842	hsa-miR-3140-3p	CLIP-seq
MIRT1143887	hsa-miR-3180-5p	CLIP-seq
MIRT2684843	hsa-miR-3182	CLIP-seq
MIRT2569760	hsa-miR-3187-3p	CLIP-seq
MIRT2569761	hsa-miR-323-3p	CLIP-seq
MIRT2684844	hsa-miR-337-3p	CLIP-seq
MIRT2569762	hsa-miR-3545-3p	CLIP-seq
MIRT1143868	hsa-miR-3659	CLIP-seq
MIRT2569764	hsa-miR-3663-5p	CLIP-seq
MIRT2569765	hsa-miR-3673	CLIP-seq
MIRT2569766	hsa-miR-3685	CLIP-seq
MIRT2569767	hsa-miR-3689d	CLIP-seq
MIRT2569768	hsa-miR-384	CLIP-seq
MIRT2684845	hsa-miR-3921	CLIP-seq
MIRT2569769	hsa-miR-411	CLIP-seq
MIRT2569771	hsa-miR-4282	CLIP-seq
MIRT1143891	hsa-miR-4319	CLIP-seq
MIRT2684846	hsa-miR-4419a	CLIP-seq
MIRT2569772	hsa-miR-4435	CLIP-seq
MIRT2569774	hsa-miR-4444	CLIP-seq
MIRT2684847	hsa-miR-4510	CLIP-seq
MIRT2270579	hsa-miR-4649-3p	CLIP-seq
MIRT2684848	hsa-miR-4653-5p	CLIP-seq
MIRT1143873	hsa-miR-4658	CLIP-seq
MIRT2569778	hsa-miR-4680-5p	CLIP-seq
MIRT2569779	hsa-miR-4698	CLIP-seq
MIRT2569780	hsa-miR-4701-5p	CLIP-seq
MIRT2684849	hsa-miR-4714-5p	CLIP-seq
MIRT1143875	hsa-miR-4716-5p	CLIP-seq
MIRT2569781	hsa-miR-4726-3p	CLIP-seq
MIRT1143894	hsa-miR-4732-3p	CLIP-seq
MIRT2569782	hsa-miR-4755-3p	CLIP-seq
MIRT2569783	hsa-miR-4765	CLIP-seq
MIRT1143876	hsa-miR-4768-5p	CLIP-seq
MIRT2569784	hsa-miR-4775	CLIP-seq
MIRT2569785	hsa-miR-4781-3p	CLIP-seq
MIRT2569786	hsa-miR-4799-5p	CLIP-seq
MIRT1143895	hsa-miR-4803	CLIP-seq
MIRT2569787	hsa-miR-516b	CLIP-seq
MIRT2569788	hsa-miR-548s	CLIP-seq
MIRT1143878	hsa-miR-574-5p	CLIP-seq
MIRT2569790	hsa-miR-588	CLIP-seq
MIRT2569791	hsa-miR-590-3p	CLIP-seq
MIRT1143900	hsa-miR-622	CLIP-seq
MIRT2569792	hsa-miR-629	CLIP-seq
MIRT2569794	hsa-miR-651	CLIP-seq
MIRT1143901	hsa-miR-670	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	32371392
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	31665743
GO:0005759	Component	Mitochondrial matrix	IDA	27974379
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0070475	Process	RRNA base methylation	IBA
GO:0070475	Process	RRNA base methylation	IDA	31665743, 32371392
GO:0071424	Function	RRNA (cytosine-N4-)-methyltransferase activity	IBA
GO:0071424	Function	RRNA (cytosine-N4-)-methyltransferase activity	IDA	31665743, 32371392

MIM	HGNC	e!Ensembl
618711	26606	ENSG00000169519

A6NJ78

Protein name

12S rRNA N(4)-cytidine methyltransferase METTL15 (12S rRNA m4C methyltransferase) (EC 2.1.1.-) (Methyltransferase 5 domain-containing protein 1) (Methyltransferase-like protein 15)

Protein function

N4-methylcytidine (m4C) methyltransferase responsible for the methylation of position C839 in mitochondrial 12S rRNA (PubMed:31665743, PubMed:32371392). Involved in the stabilization of 12S rRNA folding, therefore facilitating the assembly of th

PDB

7PNX , 7PNY , 7PNZ , 8IPI , 8IPK , 8IPL , 8IPM , 8QRL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01795	Methyltransf_5	69 → 407	MraW methylase family	Family

Sequence

MLRYPYFCRMYKECLSCWLESGIPNLGVWPNRIHTTAEKYREYEAREQTDQTQAQELHRS
QDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDR
DPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTP
ERGFSLRKDGPLDMRMDGGRYPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIV
QARSIYPITRTQQLASIVAGAFPPSAIYTRKDLLQRSTHIATKTFQALRIFVNNELNELY
TGLKTAQKFLRPGGRLVALSFHSLEDRIVKRFLLGISMTERFNLSVRQQVMKTSQLGSDH
ENTEEVSMRRAPLMWELIHKKVLSPQDQDVQDNPRGRSAKLRAAIKL

Sequence length

407

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (20)
ANXIETY DISORDER	—	GWAS catalog	39294497	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	30478444, 32606422, 33479212, 34446935, 35764056, 36137488, 36702997, 37689771, 38565336, 40962958	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	33479212, 35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	33479212	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	37156939, 37985822	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29662059, 30643256, 33479212, 37464041, 41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661, 31504550, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	36989840	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	36411363, 40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	33479212	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33479212, 35396580, 36137488, 39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY MALIGNANT NEOPLASM	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	36525587	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969, 38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37715994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TMPRSS5	5	["Anxiety disorder","Cannabis abuse","Lymphocytic leukemia","Obsessive-compulsive disorder","Psychiatric disorders"]	[]	5	["GWAS catalog (Anxiety disorder)","GWAS catalog (Cannabis abuse)","GWAS catalog (Lymphocytic leukemia)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Psychiatric disorders)"]
LRFN5	4	["Anxiety disorder","Obsessive-compulsive disorder","Post-traumatic stress disorder","Psychiatric disorders"]	[]	4	["GWAS catalog (Anxiety disorder)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Psychiatric disorders)"]
NCAM1	4	["Anxiety disorder","Cannabis abuse","Obsessive-compulsive disorder","Post-traumatic stress disorder"]	[]	4	["GWAS catalog (Anxiety disorder)","GWAS catalog (Cannabis abuse)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Post-traumatic stress disorder)"]
FURIN	5	["Anxiety disorder","Cannabis abuse","Obsessive-compulsive disorder","Post-traumatic stress disorder","Psychiatric disorders"]	[]	5	["GWAS catalog (Anxiety disorder)","GWAS catalog (Cannabis abuse)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Psychiatric disorders)"]
DLEU7	3	["Lymphocytic leukemia","Obstructive sleep apnea syndrome","Sleep apnea"]	[]	3	["GWAS catalog (Lymphocytic leukemia)","GWAS catalog (Obstructive sleep apnea syndrome)","GWAS catalog (Sleep apnea)"]

METTL15 (methyltransferase 15, mitochondrial 12S rRNA N4-cytidine)

Bookmark This Gene