Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6885
Gene name	Mitogen-activated protein kinase kinase kinase 7
Gene symbol	MAP3K7
Synonyms (NCBI Gene)	CSCFFMD2MEKK7TAK1TGF1a
Chromosome	6
Chromosome location	6q15
Summary	The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcripti

Show/Hide all (13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886039230	G>A,C,T	Pathogenic	Coding sequence variant, intron variant, missense variant
rs886039231	C>G	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039232	A>T	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039233	C>G	Pathogenic	Coding sequence variant, missense variant
rs886039234	TCTTCC>-	Pathogenic	5 prime UTR variant, inframe deletion, coding sequence variant
rs886039235	C>A	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039236	AAC>-	Pathogenic	5 prime UTR variant, inframe deletion, coding sequence variant
rs886039237	A>C,T	Pathogenic	Coding sequence variant, missense variant
rs1057517758	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064795771	C>T	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant
rs1180249151	C>A,T	Likely-pathogenic	Splice acceptor variant
rs1554184177	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1582233787	AAC>-	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, inframe deletion

375

Show/Hide all (375)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005509	hsa-miR-10a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20624982
MIRT025316	hsa-miR-34a-5p	Sequencing	20371350
MIRT005509	hsa-miR-10a-5p	Reporter assay;Other	20624982
MIRT027011	hsa-miR-103a-3p	Sequencing	20371350
MIRT051235	hsa-miR-16-5p	CLASH	23622248
MIRT036539	hsa-miR-1226-5p	CLASH	23622248
MIRT053639	hsa-miR-143-3p	Microarray	22942087
MIRT616961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT616960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616959	hsa-miR-3671	HITS-CLIP	23824327
MIRT616958	hsa-miR-5696	HITS-CLIP	23824327
MIRT616957	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT616956	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616955	hsa-miR-607	HITS-CLIP	23824327
MIRT616954	hsa-miR-1305	HITS-CLIP	23824327
MIRT616953	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT566834	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT566833	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT051235	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT566832	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT566831	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT566830	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT566829	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT566828	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT566827	hsa-miR-646	PAR-CLIP	20371350
MIRT566826	hsa-miR-875-5p	PAR-CLIP	20371350
MIRT566825	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT566824	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT566823	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT566822	hsa-miR-599	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT512942	hsa-miR-940	PAR-CLIP	20371350
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT512937	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT512936	hsa-miR-107	PAR-CLIP	20371350
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT512942	hsa-miR-940	PAR-CLIP	23446348
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT512937	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT512936	hsa-miR-107	PAR-CLIP	23446348
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT449701	hsa-miR-3914	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT735700	hsa-miR-129-5p	Luciferase reporter assayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	32048803
MIRT736428	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT616961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT616960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616959	hsa-miR-3671	HITS-CLIP	23824327
MIRT616958	hsa-miR-5696	HITS-CLIP	23824327
MIRT616957	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT616956	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616955	hsa-miR-607	HITS-CLIP	23824327
MIRT616954	hsa-miR-1305	HITS-CLIP	23824327
MIRT616953	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT566834	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT566833	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT051235	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT566832	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT566831	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT566830	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT566829	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT566828	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT566827	hsa-miR-646	PAR-CLIP	20371350
MIRT566826	hsa-miR-875-5p	PAR-CLIP	20371350
MIRT566825	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT566824	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT566823	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT566822	hsa-miR-599	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT512942	hsa-miR-940	PAR-CLIP	20371350
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT512937	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT512936	hsa-miR-107	PAR-CLIP	20371350
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT512942	hsa-miR-940	PAR-CLIP	23446348
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT512937	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT512936	hsa-miR-107	PAR-CLIP	23446348
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT449701	hsa-miR-3914	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT1129026	hsa-miR-1256	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT1129046	hsa-miR-4715-5p	CLIP-seq
MIRT1129047	hsa-miR-4716-5p	CLIP-seq
MIRT1129048	hsa-miR-494	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129061	hsa-miR-582-5p	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129064	hsa-miR-1205	CLIP-seq
MIRT1129065	hsa-miR-1286	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129067	hsa-miR-4418	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT1129068	hsa-miR-4722-5p	CLIP-seq
MIRT1129069	hsa-miR-509-3-5p	CLIP-seq
MIRT1129070	hsa-miR-509-5p	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129071	hsa-miR-1258	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT1129073	hsa-miR-15a	CLIP-seq
MIRT1129074	hsa-miR-15b	CLIP-seq
MIRT1129075	hsa-miR-16	CLIP-seq
MIRT1129076	hsa-miR-188-5p	CLIP-seq
MIRT1129077	hsa-miR-195	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT1129079	hsa-miR-3614-3p	CLIP-seq
MIRT1129080	hsa-miR-377	CLIP-seq
MIRT1129081	hsa-miR-424	CLIP-seq
MIRT1129082	hsa-miR-4509	CLIP-seq
MIRT1129083	hsa-miR-4524	CLIP-seq
MIRT1129084	hsa-miR-4528	CLIP-seq
MIRT1129085	hsa-miR-4652-3p	CLIP-seq
MIRT1129086	hsa-miR-497	CLIP-seq
MIRT1129087	hsa-miR-503	CLIP-seq
MIRT1129088	hsa-miR-507	CLIP-seq
MIRT1129089	hsa-miR-548m	CLIP-seq
MIRT1129090	hsa-miR-557	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT1551122	hsa-miR-590-3p	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129026	hsa-miR-1256	CLIP-seq
MIRT1129071	hsa-miR-1258	CLIP-seq
MIRT2266921	hsa-miR-142-5p	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT2266922	hsa-miR-297	CLIP-seq
MIRT2266923	hsa-miR-3149	CLIP-seq
MIRT2266924	hsa-miR-329	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129079	hsa-miR-3614-3p	CLIP-seq
MIRT2266925	hsa-miR-362-3p	CLIP-seq
MIRT1129080	hsa-miR-377	CLIP-seq
MIRT2266926	hsa-miR-3941	CLIP-seq
MIRT2266927	hsa-miR-421	CLIP-seq
MIRT2266928	hsa-miR-4282	CLIP-seq
MIRT2266929	hsa-miR-4474-5p	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT2266930	hsa-miR-4517	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT1129085	hsa-miR-4652-3p	CLIP-seq
MIRT2266931	hsa-miR-4694-3p	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT1129046	hsa-miR-4715-5p	CLIP-seq
MIRT1129047	hsa-miR-4716-5p	CLIP-seq
MIRT2266933	hsa-miR-4789-3p	CLIP-seq
MIRT1129048	hsa-miR-494	CLIP-seq
MIRT2266934	hsa-miR-495	CLIP-seq
MIRT2266935	hsa-miR-526b	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129061	hsa-miR-582-5p	CLIP-seq
MIRT1551122	hsa-miR-590-3p	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT2266936	hsa-miR-603	CLIP-seq
MIRT1129064	hsa-miR-1205	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129067	hsa-miR-4418	CLIP-seq
MIRT1129069	hsa-miR-509-3-5p	CLIP-seq
MIRT1129070	hsa-miR-509-5p	CLIP-seq
MIRT2453690	hsa-miR-570	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT2566477	hsa-miR-10a	CLIP-seq
MIRT2566478	hsa-miR-10b	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT2566479	hsa-miR-1273f	CLIP-seq
MIRT2566480	hsa-miR-1278	CLIP-seq
MIRT2566481	hsa-miR-129-3p	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT2266921	hsa-miR-142-5p	CLIP-seq
MIRT2566482	hsa-miR-143	CLIP-seq
MIRT2566483	hsa-miR-153	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT2566484	hsa-miR-300	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT2566485	hsa-miR-3122	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT2566486	hsa-miR-3148	CLIP-seq
MIRT2566487	hsa-miR-3153	CLIP-seq
MIRT2566488	hsa-miR-330-3p	CLIP-seq
MIRT2566489	hsa-miR-339-5p	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT2566490	hsa-miR-369-3p	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT2566491	hsa-miR-374a	CLIP-seq
MIRT2566492	hsa-miR-374b	CLIP-seq
MIRT2566493	hsa-miR-381	CLIP-seq
MIRT2566494	hsa-miR-3913-5p	CLIP-seq
MIRT2566495	hsa-miR-4421	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT2566496	hsa-miR-4477a	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT2566497	hsa-miR-4639-3p	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT2566498	hsa-miR-4668-5p	CLIP-seq
MIRT2566499	hsa-miR-4682	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT2566500	hsa-miR-4698	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT2566501	hsa-miR-4708-5p	CLIP-seq
MIRT2566502	hsa-miR-4720-5p	CLIP-seq
MIRT2566503	hsa-miR-4770	CLIP-seq
MIRT2566504	hsa-miR-4799-3p	CLIP-seq
MIRT2566505	hsa-miR-4799-5p	CLIP-seq
MIRT2566506	hsa-miR-511	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT2566507	hsa-miR-513a-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT2566508	hsa-miR-640	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT2566509	hsa-miR-889	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT2566510	hsa-miR-938	CLIP-seq
MIRT2566511	hsa-miR-944	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT2566477	hsa-miR-10a	CLIP-seq
MIRT2566478	hsa-miR-10b	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT2566479	hsa-miR-1273f	CLIP-seq
MIRT2566480	hsa-miR-1278	CLIP-seq
MIRT2566481	hsa-miR-129-3p	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT2566482	hsa-miR-143	CLIP-seq
MIRT2566483	hsa-miR-153	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT2566485	hsa-miR-3122	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT2566486	hsa-miR-3148	CLIP-seq
MIRT2566487	hsa-miR-3153	CLIP-seq
MIRT2566488	hsa-miR-330-3p	CLIP-seq
MIRT2566489	hsa-miR-339-5p	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT2566490	hsa-miR-369-3p	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT2566491	hsa-miR-374a	CLIP-seq
MIRT2566492	hsa-miR-374b	CLIP-seq
MIRT2566494	hsa-miR-3913-5p	CLIP-seq
MIRT2566495	hsa-miR-4421	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT2566496	hsa-miR-4477a	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT2566497	hsa-miR-4639-3p	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT2566498	hsa-miR-4668-5p	CLIP-seq
MIRT2566499	hsa-miR-4682	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT2566500	hsa-miR-4698	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT2566501	hsa-miR-4708-5p	CLIP-seq
MIRT2566502	hsa-miR-4720-5p	CLIP-seq
MIRT2566503	hsa-miR-4770	CLIP-seq
MIRT2566504	hsa-miR-4799-3p	CLIP-seq
MIRT2566505	hsa-miR-4799-5p	CLIP-seq
MIRT2566506	hsa-miR-511	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT2566507	hsa-miR-513a-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT2566508	hsa-miR-640	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT2566509	hsa-miR-889	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT2566510	hsa-miR-938	CLIP-seq
MIRT2566511	hsa-miR-944	CLIP-seq

117

Show/Hide all (117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	8663074, 11865055
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002726	Process	Positive regulation of T cell cytokine production	IMP	15125833
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	10702308, 11460167, 20538596
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10094049, 10702308, 11460167, 37832545
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	11865055
GO:0004709	Function	MAP kinase kinase kinase activity	EXP	11460167
GO:0004709	Function	MAP kinase kinase kinase activity	IBA
GO:0004709	Function	MAP kinase kinase kinase activity	IDA	8663074, 9079627, 11460167
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	TAS	9466656
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10094049, 11460167, 11865055, 12496252, 14743216, 15075345, 15764709, 16840345, 16845370, 17079228, 17110930, 17158449, 17363973, 17449468, 17709393, 18286207, 18591963, 18758450, 19026643, 19820695, 21512573, 21903422, 22081109, 22158122, 22904686, 25241761, 26334375, 27426733, 278
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IC	19675569, 34871740
GO:0005737	Component	Cytoplasm	IDA	12242293
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	37832545
GO:0005829	Component	Cytosol	IDA	12242293
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IDA	10748004
GO:0006954	Process	Inflammatory response	IDA	34017102
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	9466656
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9244310, 9252186, 9346484, 25038658, 34721373
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	10882101, 19675569, 34871740, 35952808
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS
GO:0007252	Process	I-kappaB phosphorylation	IDA	11460167
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	9079627
GO:0007254	Process	JNK cascade	TAS
GO:0008349	Function	MAP kinase kinase kinase kinase activity	TAS
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	18762249
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	24936062
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0032527	Process	Protein exit from endoplasmic reticulum	IDA	32690950, 37832545
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	15125833
GO:0034138	Process	Toll-like receptor 3 signaling pathway	TAS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 25355951, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25371197
GO:0035173	Function	Histone kinase activity	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0035872	Process	Nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 26189595
GO:0038066	Process	P38MAPK cascade	IDA	10330143, 11460167
GO:0038066	Process	P38MAPK cascade	IDA	11460167
GO:0038066	Process	P38MAPK cascade	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	20532808
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	31376257
GO:0042742	Process	Defense response to bacterium	IDA	11460167
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	24936062
GO:0042770	Process	Signal transduction in response to DNA damage	TAS	24936062
GO:0042802	Function	Identical protein binding	IPI	27426733
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	9346484
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11460167
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	14982987
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	25038658
GO:0043276	Process	Anoikis	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	11460167
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	NAS	15125833
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9079627
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	10094049
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097110	Function	Scaffold protein binding	IDA	23776175
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140672	Component	ATAC complex	IDA	18838386
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800
GO:0141111	Process	Positive regulation of cGAS/STING signaling pathway	IDA	37832545
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	10094049
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IEA
GO:1990450	Function	Linear polyubiquitin binding	IDA	35952808
GO:1990776	Process	Response to angiotensin	IEA

MIM	HGNC	e!Ensembl
602614	6859	ENSG00000135341

O43318

Protein name

Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:10094049, PubMed:11460167, PubMed:12589052, PubMed:16845370, PubMed:16893890, PubMed:21512573, PubMed:8663074, PubMed:9079627). Pl

PDB

2EVA , 2YIY , 4GS6 , 4L3P , 4L52 , 4L53 , 4O91 , 5E7R , 5GJD , 5GJF , 5GJG , 5J7S , 5J8I , 5J9L , 5JGA , 5JGB , 5JGD , 5JH6 , 5JK3 , 5V5N , 7NTH , 7NTI , 8GW3 , 9FPD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	36 → 284	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1A is the most abundant in ovary, skeletal muscle, spleen and blood mononuclear cells. Isoform 1B is highly expressed in brain, kidney and small intestine. Isoform 1C is the major form in prostate. Isoform 1D is the less abunda

Sequence

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS

Sequence length

606

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cardiospondylocarpofacial syndrome	Likely pathogenic; Pathogenic	rs2127974446, rs2127975274, rs886039234, rs886039235, rs886039236, rs886039237, rs1582233787, rs1776199533	RCV001527388 RCV001836671 RCV000254560 RCV000254563 RCV000254567 RCV000254561 RCV000845245 RCV001251209 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontometaphyseal dysplasia 2	Likely pathogenic; Pathogenic	rs2127974446, rs886039230, rs886039231, rs886039232, rs886039233, rs1180249151	RCV001527388 RCV000254565 RCV000254559 RCV000254562 RCV000254566 RCV000985236 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (36)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THROMBOCYTOPENIC PURPURA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, PANCREATIC DUCTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delayed skeletal maturation	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EHLERS-DANLOS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOMETAPHYSEAL DYSPLASIA	—	CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET MYASTHENIA GRAVIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAP3K7-related disorder	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (217)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29914415, 31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25287709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26291056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30907011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	22649101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	34508164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30146158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	34930825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28039186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29029426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28220341, 31847895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26776603, 27847407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27995356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29029426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28323847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28323847	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31808606		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28560435, 29511289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24466111, 28521404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17828308, 21700681, 21834757, 22767217, 23973329, 25189770, 25557171, 28224764, 28537667, 28627683, 28746466		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16000313, 19049961, 21834757, 27599572, 28746466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34075691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30656528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21721029, 23472066, 24565101, 34841685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24466111, 28521404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9466656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31485280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23534745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28102840	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31485280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35730652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiospondylocarpofacial syndrome	Cardiospondylocarpofacial Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Carpal synostosis	Carpal synostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29776451, 31410157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29776451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	31329361		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28430599		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	28430599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26617776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16940043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26114584, 27655129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39333335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23547054, 28912140, 29290971, 30515612, 30979739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21834757, 27655129, 29328486, 31592535, 36270986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital dislocation of radial head	Dislocated radial head	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital fusion of ribs	Rib fusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	29904178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29467388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	29467388, 35730652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	32299812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23534745, 25261726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39445733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19572373, 26185333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26185333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14734742, 20604713, 29524885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29163172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	27426734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27426734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27268284, 31028803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28256087, 30907011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	LHGDN	16251197, 16527194		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	20222921		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	20222921		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	20222921		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	20222921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31485280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26291056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	32299812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26882989, 30582764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29291351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	30429363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28875549, 31808606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontometaphyseal dysplasia	Frontometaphyseal Dysplasia	BEFREE	27426733		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontometaphyseal dysplasia	Frontometaphyseal Dysplasia	ORPHANET_DG	27426733		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontometaphyseal dysplasia	Frontometaphyseal dysplasia	Pubtator	27426733, 29467388, 32299812, 35730652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontometaphyseal dysplasia	Frontometaphyseal Dysplasia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontometaphyseal dysplasia	Frontometaphyseal Dysplasia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontometaphyseal dysplasia	Frontometaphyseal Dysplasia	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	GENOMICS_ENGLAND_DG	27426733		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 2	Frontometaphyseal Dysplasia	GENOMICS_ENGLAND_DG	25899317, 27426733, 30914295		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FRONTOMETAPHYSEAL DYSPLASIA 2	Frontometaphyseal Dysplasia	UNIPROT_DG	27426733		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FRONTOMETAPHYSEAL DYSPLASIA 2	Frontometaphyseal Dysplasia	BEFREE	29660408		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FRONTOMETAPHYSEAL DYSPLASIA 2	Frontometaphyseal Dysplasia	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30146158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	24082073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	29467388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30846550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38002938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29667914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	BEFREE	30537632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29027124, 31846439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	32105826, 32299812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22641218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	29904178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29467388, 35730652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Congenital heart septal defect	Pubtator	32105826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	32105826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	17379072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hip Contracture	Hip Contracture	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	22649101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	39445733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	34930825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30554141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38359662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	29414666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21159881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	27995356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31196660, 31813254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29991691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10607714, 21820422, 29914415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25287709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20159944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20159944, 22096027, 25287709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21721029, 26973245, 28875549, 31214512, 31367864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29147012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36309313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23370768	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26823762, 26884850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	29914415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22649101, 29511289		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	22649101	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29511289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22649101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17828308, 21834757, 22767217, 23973329, 25189770, 25557171, 28224764, 28260101, 28537667, 28627683, 28746466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9466656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21743023, 23547054, 31562256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17785553, 23370768, 26501111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28560435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24466111, 28521404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22644295, 23272845, 23523871, 23534745, 24466111, 25557171, 28011204, 28038940, 28224764, 28231796, 28875549, 28906490, 28912140, 29145973, 29163172, 29712904, 29807222, 31214512 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28430599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22341439, 26114584, 27655129, 29145973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18316610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25557171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22649101		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17173073, 22898869, 25889255, 30850732		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17173073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17173073, 25889255, 31549767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27981609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	BEFREE	23460641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24466111, 29296860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24466111, 36121114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28121444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34271980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34930825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27099262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	28121444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17785553, 17828308, 20585109, 22898869, 23272845, 23370768, 23503457, 23534745, 24443058, 28410990, 28430599, 29145973, 29712904, 30576901, 30639056 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10607714, 11699391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30582764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29901173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	35730652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29348847, 30367484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	31776786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24547725, 28668088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29327611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32945454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21743023, 23547054, 31562256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	27634200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	16273260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31819531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28194669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	22384029, 31647008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29914415, 31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29914415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12967473, 23370768, 26501111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23370768, 26501111, 31300540, 32763409, 33115829, 33846123	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30554141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26617776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25261726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14734742, 27820799, 28220341, 31376257, 31847895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27196764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29467388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23272845, 28102840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23272845, 26406417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22641218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30642944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26882989, 26973245, 27981609, 30582764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28560435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24082073, 26846663, 28560435, 28714004, 34075691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29273596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tarsal Coalition	Tarsal Coalition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26823762, 33966040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tracheal Stenosis	Tracheal Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28224764, 29777109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32054925, 33461373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	23460641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24466111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP3K7 (mitogen-activated protein kinase kinase kinase 7)