Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7189
Gene name	TNF receptor associated factor 6
Gene symbol	TRAF6
Synonyms (NCBI Gene)	MGC:3310RNF85
Chromosome	11
Chromosome location	11p12
Summary	The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This protein mediates signaling fro

589

Show/Hide all (589)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000711	hsa-miR-146a-5p	Western blotNorthern blot	18504431
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	20061417
MIRT000711	hsa-miR-146a-5p	qRT-PCRflowLuciferase reporter assayWestern blot	20375304
MIRT000711	hsa-miR-146a-5p	qRT-PCR	18759964
MIRT000711	hsa-miR-146a-5p	ImmunoprecipitaionWestern blotCommunoprecipitaion	19898489
MIRT000711	hsa-miR-146a-5p	qRT-PCRWestern blotImmunofluorescence	19918258
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT005394	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT005394	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000711	hsa-miR-146a-5p	ELISALuciferase reporter assayNorthern blotqRT-PCRWestern blot	20542134
MIRT000711	hsa-miR-146a-5p	ELISALuciferase reporter assayNorthern blotqRT-PCRWestern blot	20542134
MIRT000711	hsa-miR-146a-5p	qRT-PCRWestern blot	21178010
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	21610143
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	22593544
MIRT000711	hsa-miR-146a-5p	Western blot	20110513
MIRT000711	hsa-miR-146a-5p	ELISANorthern blotWestern blot	23685241
MIRT000711	hsa-miR-146a-5p	Microarray	25205119
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	24360988
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	24360988
MIRT000711	hsa-miR-146a-5p	Microarray	25205119
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	24360988
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	24360988
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT565237	hsa-miR-6134	PAR-CLIP	20371350
MIRT565236	hsa-miR-377-5p	PAR-CLIP	20371350
MIRT565235	hsa-miR-6086	PAR-CLIP	20371350
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT565233	hsa-miR-3689d	PAR-CLIP	20371350
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT565227	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT130055	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT482826	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT130042	hsa-miR-1253	PAR-CLIP	23592263
MIRT482825	hsa-miR-4419a	PAR-CLIP	23592263
MIRT482824	hsa-miR-4510	PAR-CLIP	23592263
MIRT482822	hsa-miR-6127	PAR-CLIP	23592263
MIRT482823	hsa-miR-6129	PAR-CLIP	23592263
MIRT482821	hsa-miR-6130	PAR-CLIP	23592263
MIRT482820	hsa-miR-6133	PAR-CLIP	23592263
MIRT482819	hsa-miR-4434	PAR-CLIP	23592263
MIRT482818	hsa-miR-4516	PAR-CLIP	23592263
MIRT482817	hsa-miR-5703	PAR-CLIP	23592263
MIRT482816	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT482815	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT482813	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT482814	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT482812	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT482811	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT482810	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT482809	hsa-miR-3175	PAR-CLIP	23592263
MIRT482808	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT482807	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT482806	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482805	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT482803	hsa-miR-6745	PAR-CLIP	23592263
MIRT482804	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT482802	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT482801	hsa-miR-1293	PAR-CLIP	23592263
MIRT482800	hsa-miR-4483	PAR-CLIP	23592263
MIRT482799	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT482798	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482797	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482796	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT482794	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482795	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT482793	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT482792	hsa-miR-3202	PAR-CLIP	23592263
MIRT383128	hsa-miR-5692a	PAR-CLIP	22100165
MIRT449133	hsa-miR-3163	PAR-CLIP	22100165
MIRT383129	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT449132	hsa-miR-1827	PAR-CLIP	22100165
MIRT449131	hsa-miR-633	PAR-CLIP	22100165
MIRT449130	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT449129	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT449128	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT449127	hsa-miR-6083	PAR-CLIP	22100165
MIRT449126	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT439396	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT439396	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT000711	hsa-miR-146a-5p	Next Generation Sequencing (NGS)Northern blotpSILAC	26151128
MIRT000711	hsa-miR-146a-5p	Next Generation Sequencing (NGS)Northern blotpSILAC	26151128
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT005394	hsa-miR-146b-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26320176
MIRT732113	mmu-miR-146a-3p	qRT-PCRWestern blot	28161709
MIRT732113	mmu-miR-146a-3p	qRT-PCRWestern blot	28161709
MIRT000711	hsa-miR-146a-5p	qRT-PCRWestern blot	25889446
MIRT000711	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27904767
MIRT000711	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27904767
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	26701625
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	26701625
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT565233	hsa-miR-3689d	PAR-CLIP	26701625
MIRT565233	hsa-miR-3689d	PAR-CLIP	26701625
MIRT565236	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT565236	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT565227	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT565227	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT565235	hsa-miR-6086	PAR-CLIP	26701625
MIRT565235	hsa-miR-6086	PAR-CLIP	26701625
MIRT565237	hsa-miR-6134	PAR-CLIP	26701625
MIRT565237	hsa-miR-6134	PAR-CLIP	26701625
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT000711	hsa-miR-146a-5p	ChIP-seqELISAqRT-PCR	34203452
MIRT000711	hsa-miR-146a-5p	Immunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33897883
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33897883
MIRT734332	hsa-miR-143-3p	ELISAqRT-PCR	33430976
MIRT734333	hsa-miR-146a-3p	ELISAqRT-PCR	33430976
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	33459883
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRFlow cytometry	32328683
MIRT735423	hsa-miR-125b-5p	qRT-PCR	32039213
MIRT735589	hsa-miR-590-3p	Luciferase reporter assayWestern blottingMicroarray	32123831
MIRT734333	hsa-miR-146a-3p	Western blottingqRT-PCRFlow cytometryELISA	32117283
MIRT736444	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT736519	hsa-miR-140-3p	Luciferase reporter assayWestern blottingqRT-PCRELISA	31882548
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqqRT-PCRFlow cytometry	32226532
MIRT736519	hsa-miR-140-3p	Luciferase reporter assayWestern blottingqRT-PCRELISA	31882548
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT565237	hsa-miR-6134	PAR-CLIP	20371350
MIRT565236	hsa-miR-377-5p	PAR-CLIP	20371350
MIRT565235	hsa-miR-6086	PAR-CLIP	20371350
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT565233	hsa-miR-3689d	PAR-CLIP	20371350
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT565227	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT130055	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT482826	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT130042	hsa-miR-1253	PAR-CLIP	23592263
MIRT482825	hsa-miR-4419a	PAR-CLIP	23592263
MIRT482824	hsa-miR-4510	PAR-CLIP	23592263
MIRT482822	hsa-miR-6127	PAR-CLIP	23592263
MIRT482823	hsa-miR-6129	PAR-CLIP	23592263
MIRT482821	hsa-miR-6130	PAR-CLIP	23592263
MIRT482820	hsa-miR-6133	PAR-CLIP	23592263
MIRT482819	hsa-miR-4434	PAR-CLIP	23592263
MIRT482818	hsa-miR-4516	PAR-CLIP	23592263
MIRT482817	hsa-miR-5703	PAR-CLIP	23592263
MIRT482816	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT482815	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT482813	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT482814	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT482812	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT482811	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT482810	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT482809	hsa-miR-3175	PAR-CLIP	23592263
MIRT482808	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT482807	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT482806	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482805	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT482803	hsa-miR-6745	PAR-CLIP	23592263
MIRT482804	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT482802	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT482801	hsa-miR-1293	PAR-CLIP	23592263
MIRT482800	hsa-miR-4483	PAR-CLIP	23592263
MIRT482799	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT482798	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482797	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482796	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT482794	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482795	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT482793	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT482792	hsa-miR-3202	PAR-CLIP	23592263
MIRT383128	hsa-miR-5692a	PAR-CLIP	22100165
MIRT449133	hsa-miR-3163	PAR-CLIP	22100165
MIRT383129	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT449132	hsa-miR-1827	PAR-CLIP	22100165
MIRT449131	hsa-miR-633	PAR-CLIP	22100165
MIRT449130	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT449129	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT449128	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT449127	hsa-miR-6083	PAR-CLIP	22100165
MIRT449126	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT755561	miR-495-3p	Luciferase reporter assayWestern blottingqRT-PCR	35784154
MIRT755561	miR-495-3p	Luciferase reporter assayWestern blottingqRT-PCR	35784154
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)Immunofluorescence	37391426
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35777802
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	36175984
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35240920
MIRT1451095	hsa-miR-1208	CLIP-seq
MIRT1451096	hsa-miR-1229	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT1451098	hsa-miR-124	CLIP-seq
MIRT1451099	hsa-miR-1258	CLIP-seq
MIRT1451100	hsa-miR-1273f	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT1451103	hsa-miR-143	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451107	hsa-miR-181a	CLIP-seq
MIRT1451108	hsa-miR-181b	CLIP-seq
MIRT1451109	hsa-miR-181c	CLIP-seq
MIRT1451110	hsa-miR-181d	CLIP-seq
MIRT1451111	hsa-miR-1914	CLIP-seq
MIRT1451112	hsa-miR-1915	CLIP-seq
MIRT1451113	hsa-miR-194	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451115	hsa-miR-197	CLIP-seq
MIRT1451116	hsa-miR-2115	CLIP-seq
MIRT1451117	hsa-miR-218	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT1451119	hsa-miR-302a	CLIP-seq
MIRT1451120	hsa-miR-302b	CLIP-seq
MIRT1451121	hsa-miR-302c	CLIP-seq
MIRT1451122	hsa-miR-302d	CLIP-seq
MIRT1451123	hsa-miR-302e	CLIP-seq
MIRT1451124	hsa-miR-3064-3p	CLIP-seq
MIRT1451125	hsa-miR-3148	CLIP-seq
MIRT1451126	hsa-miR-3185	CLIP-seq
MIRT1451127	hsa-miR-3187-3p	CLIP-seq
MIRT1451128	hsa-miR-34b	CLIP-seq
MIRT1451129	hsa-miR-3663-5p	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451132	hsa-miR-3691-5p	CLIP-seq
MIRT1451133	hsa-miR-370	CLIP-seq
MIRT1451134	hsa-miR-3714	CLIP-seq
MIRT1451135	hsa-miR-372	CLIP-seq
MIRT1451136	hsa-miR-373	CLIP-seq
MIRT1451137	hsa-miR-3911	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451139	hsa-miR-421	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451143	hsa-miR-4262	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT1451145	hsa-miR-4280	CLIP-seq
MIRT1451146	hsa-miR-4289	CLIP-seq
MIRT1451147	hsa-miR-4320	CLIP-seq
MIRT1451148	hsa-miR-4330	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451150	hsa-miR-4435	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT1451152	hsa-miR-4464	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT1451154	hsa-miR-4519	CLIP-seq
MIRT1451155	hsa-miR-452	CLIP-seq
MIRT1451156	hsa-miR-4532	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT1451158	hsa-miR-4663	CLIP-seq
MIRT1451159	hsa-miR-4676-3p	CLIP-seq
MIRT1451160	hsa-miR-4701-5p	CLIP-seq
MIRT1451161	hsa-miR-4708-5p	CLIP-seq
MIRT1451162	hsa-miR-4709-5p	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451164	hsa-miR-4726-3p	CLIP-seq
MIRT1451165	hsa-miR-4748	CLIP-seq
MIRT1451166	hsa-miR-4752	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451169	hsa-miR-4770	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451173	hsa-miR-4795-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451176	hsa-miR-498	CLIP-seq
MIRT1451177	hsa-miR-506	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT1451180	hsa-miR-512-3p	CLIP-seq
MIRT1451181	hsa-miR-513a-3p	CLIP-seq
MIRT1451182	hsa-miR-513a-5p	CLIP-seq
MIRT1451183	hsa-miR-516a-3p	CLIP-seq
MIRT1451184	hsa-miR-520a-3p	CLIP-seq
MIRT1451185	hsa-miR-520b	CLIP-seq
MIRT1451186	hsa-miR-520c-3p	CLIP-seq
MIRT1451187	hsa-miR-520d-3p	CLIP-seq
MIRT1451188	hsa-miR-520e	CLIP-seq
MIRT1451189	hsa-miR-539	CLIP-seq
MIRT1451190	hsa-miR-548a-3p	CLIP-seq
MIRT1451191	hsa-miR-548ae	CLIP-seq
MIRT1451192	hsa-miR-548aj	CLIP-seq
MIRT1451193	hsa-miR-548am	CLIP-seq
MIRT1451194	hsa-miR-548an	CLIP-seq
MIRT1451195	hsa-miR-548e	CLIP-seq
MIRT1451196	hsa-miR-548f	CLIP-seq
MIRT1451197	hsa-miR-548s	CLIP-seq
MIRT1451198	hsa-miR-548x	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451200	hsa-miR-579	CLIP-seq
MIRT1451201	hsa-miR-588	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT1451203	hsa-miR-636	CLIP-seq
MIRT1451204	hsa-miR-649	CLIP-seq
MIRT1451205	hsa-miR-664	CLIP-seq
MIRT1451206	hsa-miR-873	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451208	hsa-miR-944	CLIP-seq
MIRT1451209	hsa-miR-1246	CLIP-seq
MIRT1451210	hsa-miR-146a	CLIP-seq
MIRT1451211	hsa-miR-198	CLIP-seq
MIRT1451212	hsa-miR-3134	CLIP-seq
MIRT1451213	hsa-miR-33a	CLIP-seq
MIRT1451214	hsa-miR-33b	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451133	hsa-miR-370	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451215	hsa-miR-3942-3p	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451216	hsa-miR-4461	CLIP-seq
MIRT1451217	hsa-miR-4469	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT1451158	hsa-miR-4663	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451218	hsa-miR-4773	CLIP-seq
MIRT1451219	hsa-miR-483-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451189	hsa-miR-539	CLIP-seq
MIRT1451194	hsa-miR-548an	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451220	hsa-miR-580	CLIP-seq
MIRT1451221	hsa-miR-586	CLIP-seq
MIRT1451222	hsa-miR-589	CLIP-seq
MIRT1451223	hsa-miR-642a	CLIP-seq
MIRT1451224	hsa-miR-651	CLIP-seq
MIRT1451225	hsa-miR-759	CLIP-seq
MIRT1451226	hsa-miR-767-5p	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT1555185	hsa-miR-637	CLIP-seq
MIRT1920997	hsa-miR-4742-3p	CLIP-seq
MIRT1451173	hsa-miR-4795-3p	CLIP-seq
MIRT1451099	hsa-miR-1258	CLIP-seq
MIRT2134840	hsa-miR-1298	CLIP-seq
MIRT1451210	hsa-miR-146a	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT2134842	hsa-miR-3120-3p	CLIP-seq
MIRT2134843	hsa-miR-3158-3p	CLIP-seq
MIRT2134844	hsa-miR-3158-5p	CLIP-seq
MIRT2134845	hsa-miR-3165	CLIP-seq
MIRT2134846	hsa-miR-323-3p	CLIP-seq
MIRT2134847	hsa-miR-3622b-5p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451134	hsa-miR-3714	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451139	hsa-miR-421	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT2134849	hsa-miR-4283	CLIP-seq
MIRT2134850	hsa-miR-4307	CLIP-seq
MIRT1451147	hsa-miR-4320	CLIP-seq
MIRT1451148	hsa-miR-4330	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2134851	hsa-miR-4489	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2134852	hsa-miR-4656	CLIP-seq
MIRT2134853	hsa-miR-4704-5p	CLIP-seq
MIRT1451162	hsa-miR-4709-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT2134855	hsa-miR-4766-5p	CLIP-seq
MIRT2134856	hsa-miR-485-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT2134857	hsa-miR-548aa	CLIP-seq
MIRT2134858	hsa-miR-548t	CLIP-seq
MIRT2134859	hsa-miR-548v	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2134860	hsa-miR-561	CLIP-seq
MIRT2134861	hsa-miR-570	CLIP-seq
MIRT2134862	hsa-miR-576-3p	CLIP-seq
MIRT1451222	hsa-miR-589	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT2134864	hsa-miR-720	CLIP-seq
MIRT2134865	hsa-miR-888	CLIP-seq
MIRT2134866	hsa-miR-889	CLIP-seq
MIRT2134867	hsa-miR-939	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451098	hsa-miR-124	CLIP-seq
MIRT2134840	hsa-miR-1298	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451177	hsa-miR-506	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2356097	hsa-miR-1245b-3p	CLIP-seq
MIRT1451100	hsa-miR-1273f	CLIP-seq
MIRT1451103	hsa-miR-143	CLIP-seq
MIRT1451115	hsa-miR-197	CLIP-seq
MIRT2356098	hsa-miR-2278	CLIP-seq
MIRT2356099	hsa-miR-2467-3p	CLIP-seq
MIRT1451124	hsa-miR-3064-3p	CLIP-seq
MIRT1451125	hsa-miR-3148	CLIP-seq
MIRT2134844	hsa-miR-3158-5p	CLIP-seq
MIRT2356100	hsa-miR-331-3p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451132	hsa-miR-3691-5p	CLIP-seq
MIRT2356101	hsa-miR-3923	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT2134849	hsa-miR-4283	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT2356102	hsa-miR-4468	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2134851	hsa-miR-4489	CLIP-seq
MIRT2356103	hsa-miR-4645-3p	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2134852	hsa-miR-4656	CLIP-seq
MIRT1451161	hsa-miR-4708-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451169	hsa-miR-4770	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT1451190	hsa-miR-548a-3p	CLIP-seq
MIRT2134857	hsa-miR-548aa	CLIP-seq
MIRT1451195	hsa-miR-548e	CLIP-seq
MIRT1451196	hsa-miR-548f	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2134861	hsa-miR-570	CLIP-seq
MIRT2134864	hsa-miR-720	CLIP-seq
MIRT1451226	hsa-miR-767-5p	CLIP-seq
MIRT2356104	hsa-miR-890	CLIP-seq
MIRT2356105	hsa-miR-942	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT2396269	hsa-miR-3616-3p	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451145	hsa-miR-4280	CLIP-seq
MIRT2396270	hsa-miR-4446-5p	CLIP-seq
MIRT2396271	hsa-miR-4457	CLIP-seq
MIRT1451152	hsa-miR-4464	CLIP-seq
MIRT1451154	hsa-miR-4519	CLIP-seq
MIRT1451165	hsa-miR-4748	CLIP-seq
MIRT2396272	hsa-miR-4755-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT2396273	hsa-miR-516a-5p	CLIP-seq
MIRT1451206	hsa-miR-873	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2649608	hsa-miR-1273e	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT2649609	hsa-miR-202	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT2649610	hsa-miR-3065-5p	CLIP-seq
MIRT2649611	hsa-miR-3122	CLIP-seq
MIRT2649612	hsa-miR-3128	CLIP-seq
MIRT2649613	hsa-miR-3197	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT2649614	hsa-miR-3913-5p	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT2649615	hsa-miR-4470	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2649616	hsa-miR-4536	CLIP-seq
MIRT2649617	hsa-miR-4637	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2649618	hsa-miR-4681	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT2649619	hsa-miR-4767	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451219	hsa-miR-483-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT2649620	hsa-miR-548k	CLIP-seq
MIRT2649621	hsa-miR-548p	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2649622	hsa-miR-556-5p	CLIP-seq
MIRT2649623	hsa-miR-564	CLIP-seq
MIRT2649624	hsa-miR-582-3p	CLIP-seq
MIRT2649625	hsa-miR-583	CLIP-seq
MIRT2649626	hsa-miR-593	CLIP-seq
MIRT2649627	hsa-miR-624	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2694050	hsa-miR-1268	CLIP-seq
MIRT2694051	hsa-miR-1268b	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT2694052	hsa-miR-3613-3p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2694053	hsa-miR-4486	CLIP-seq
MIRT2649616	hsa-miR-4536	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2649618	hsa-miR-4681	CLIP-seq
MIRT2694054	hsa-miR-4698	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2649622	hsa-miR-556-5p	CLIP-seq
MIRT2649623	hsa-miR-564	CLIP-seq
MIRT2694055	hsa-miR-585	CLIP-seq
MIRT2649626	hsa-miR-593	CLIP-seq
MIRT2649627	hsa-miR-624	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Activation	17956589

148

Show/Hide all (148)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	20713597, 23202584, 23392225, 23524951, 25891078, 28890335, 33637724
GO:0000045	Process	Autophagosome assembly	IDA	23524951
GO:0000045	Process	Autophagosome assembly	IMP	30778222
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18093978
GO:0000209	Process	Protein polyubiquitination	IDA	15125833, 19675569
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0001503	Process	Ossification	IEA
GO:0001503	Process	Ossification	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002376	Process	Immune system process	IEA
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002726	Process	Positive regulation of T cell cytokine production	IMP	15125833
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	21931555, 29441066, 34796041
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	20501938, 23015697
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	15361868, 17135271, 17728323, 26620909
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10094049, 10465784, 10514511, 10920205, 11238466, 11244088, 11279055, 11397809, 11463333, 11518704, 11728344, 11751921, 12140561, 12242293, 12270937, 12459498, 12496252, 12925853, 14530355, 14982987, 15121867, 15125833, 15280356, 15998638, 16189514, 16286467, 16378096, 16874300, 169
GO:0005634	Component	Nucleus	IDA	18093978
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	19675569
GO:0005737	Component	Cytoplasm	IDA	22851693, 23015697
GO:0005737	Component	Cytoplasm	IDA	16378096, 18093978
GO:0005737	Component	Cytoplasm	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	18093978
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006955	Process	Immune response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9252186, 10882101, 19675569, 34721373
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	20038579, 26839314
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	25515214
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0009299	Process	MRNA transcription	IDA	9891032
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0023035	Process	CD40 signaling pathway	IDA	8910514
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	18758450
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IC	19825828
GO:0031398	Process	Positive regulation of protein ubiquitination	NAS	22412986
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IDA	23776175
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0032147	Process	Activation of protein kinase activity	IDA	17135271
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	15125833
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	23776175
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	12296995
GO:0034138	Process	Toll-like receptor 3 signaling pathway	TAS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 25355951, 25371197, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25371197
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	15465037, 27746020
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 26189595
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	19675569
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	31376257
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	35183823
GO:0042088	Process	T-helper 1 type immune response	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042742	Process	Defense response to bacterium	IDA	11460167, 18079694
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	19465916, 21988832, 22493164, 25416956, 27107012, 32296183
GO:0042826	Function	Histone deacetylase binding	IPI	18093978
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IBA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	9346484, 11460167, 18079694
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11751921, 17135271, 27746020
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	12296995
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	25038658, 27746020
GO:0043422	Function	Protein kinase B binding	IPI	19713527
GO:0043507	Process	Positive regulation of JUN kinase activity	NAS	17135271
GO:0045087	Process	Innate immune response	IBA
GO:0045453	Process	Bone resorption	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	11751921, 17135271
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18093978
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11751921
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22412986
GO:0046330	Process	Positive regulation of JNK cascade	IDA	11751921
GO:0046849	Process	Bone remodeling	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048468	Process	Cell development	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11751921
GO:0050852	Process	T cell receptor signaling pathway	IDA	23514740
GO:0050852	Process	T cell receptor signaling pathway	IMP	15125833
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	16378096
GO:0051865	Process	Protein autoubiquitination	IDA	23776175
GO:0051865	Process	Protein autoubiquitination	IDA	17135271, 18093978
GO:0051865	Process	Protein autoubiquitination	TAS	16378096
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	15125833, 15465037, 17135271, 18758450, 19675569, 19713527, 23015697, 23514740, 23524951, 26839314, 30927622, 33799071
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19713527, 20038579, 21068390, 23015697, 23524951, 27746020, 33799071
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IGI	17135271, 19675569
GO:0070555	Process	Response to interleukin-1	IDA	17135271
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	27746020
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	25515214
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	9891032, 14703513
GO:0140374	Process	Antiviral innate immune response	IDA	18984593
GO:0141124	Process	Intracellular signaling cassette	IEA
GO:0141198	Process	Protein branched polyubiquitination	IDA	27746020
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214

MIM	HGNC	e!Ensembl
602355	12036	ENSG00000175104

Q9Y4K3

Protein name

TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)

Protein function

E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as ECSIT, IKBKG, IRAK1, AKT1 and AKT2 (PubMed:11057907, PubMed:18347055, PubMed:19465916, PubMe

PDB

1LB4 , 1LB5 , 1LB6 , 2ECI , 2JMD , 3HCS , 3HCT , 3HCU , 4Z8M , 5ZUJ , 6A33 , 7L3L , 8HZ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13923	zf-C3HC4_2	69 → 107		Domain
PF18048	TRAF6_Z2	157 → 183	TNF receptor-associated factor 6 zinc finger 2	Domain
PF02176	zf-TRAF	204 → 261	TRAF-type zinc finger	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Sequence length

522

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT HYPOHIDROTIC ECTODERMAL DYSPLASIA	—	GenCC, Orphanet GenCC, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT HYPOHIDROTIC ECTODERMAL DYSPLASIA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRAF6-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (236)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23055197, 26847475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29577454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30103950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31361168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29417448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30272291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	BEFREE	12060722, 16251197		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24301457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	12531807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20644648, 29175266, 29201219, 29406859, 30017935, 30612848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25522907, 30412852, 30626891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18759964, 19898481, 22231568, 22656185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20953186, 23116200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24568840, 28338920, 31435003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20644648, 29175266, 29201219, 29406859, 30017935, 30612848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28323847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28323847, 37169841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	23867620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22231568, 23867620, 29950522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypohidrotic ectodermal dysplasia	Hypohidrotic ectodermal dysplasia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant hypohidrotic ectodermal dysplasia syndrome (disorder)	Hypohidrotic Ectodermal Dysplasia, X-Linked	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29382759, 29569854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29171041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28781679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	17728323, 20529958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	28122920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29196212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18922969, 27918549, 28627683, 30945383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34036857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23055197, 24302991, 38245869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30281815, 30782845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28781679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21911935, 23055197, 26847475, 27911870, 31578830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38197755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22450746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29175266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29175266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29114077, 29651950		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29693168, 30864722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29693168, 30864722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	12060722, 14699584, 16251197, 22296312, 22924441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28470929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28549054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	35034548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28687809		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29651950, 30763583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29563609, 30654310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24755241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30806153, 31289563, 31487530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25242495, 31882548, 35179811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29175266, 30612848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20524934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23794009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20524934, 23794009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20524934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	23794009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	17562858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28314786, 31056254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30571666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31156649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	27889748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28598282, 29689277, 30017935, 30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29745371, 30017935, 30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21249428, 27062898, 29046236, 29058209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	27062898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27062898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23632891, 30165192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	LHGDN	12270937, 16251197, 16527194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia 1 Anhidrotic	Ectodermal dysplasia	Pubtator	31652981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	22296312, 22924441		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	14699584, 22296312, 22924441		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	22296312, 22924441		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	14699584, 22296312, 22924441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21312055, 27697099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21312055, 27697099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27697099	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	16230348	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31222801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29382328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	22589256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26320176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29048680, 30571666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29048680, 30571666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23358926, 26320176, 29048680, 30288851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26320176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31974601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30103950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28219358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	28219358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29175266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30224945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29175266, 30612848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37102608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24168509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11144929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21454471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20644648, 31479774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31338525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	19898481, 40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30556735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16635910, 26564988, 30949903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23431243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26419460	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	29038477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29745371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23726813, 25999280, 28811005, 29114077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31671112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28549054	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30392071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28549054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	35045331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22685174, 35045331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19898489, 22685174, 25199827, 28789366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19898489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29703234, 30945383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28404923, 30074282, 30281815, 30782845, 31155734, 31509261, 31822654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28687809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	38215866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23055197	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24321786, 25605144, 26847475, 27911870, 35422093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22231568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22231568, 36177494, 38360126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23497717	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	22231568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21179067, 22231568, 25496163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	23896866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28338190, 28549054, 29630120, 29754557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28338190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28549054	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	22231568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25605144, 35179811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29193723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21041452, 30165192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21041452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	29569854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	29569854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29569854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26320176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18922969, 27918549, 28627683, 30945383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21312055, 27697099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28372569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21911935, 23055197, 26847475, 27911870, 31578830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29703234, 30945383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26052093, 30673917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25712341, 27869166, 28676490, 29202848, 31262711, 31712163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23013936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28781679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23794111, 24026882, 24755241, 25061874, 26769849, 27697099, 27918549, 28231796, 28372569, 28789366, 28884970, 29193723, 29437707, 29463844, 29625265 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29693168, 30864722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24755241		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26769849, 27791197, 28612997, 30253283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30571666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29703234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17363736, 28122920, 30736330, 33323675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22440007, 28122920, 28789366, 30736330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28494768, 30471110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	32210951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	33997016, 35978310	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	28024152		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22685174, 28024152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22685174, 37102608, 40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30929559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28886971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	27388770	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	11418661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31699119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16230348, 20164024, 21610143, 22240197, 22886393, 24301457, 24302991, 24755241, 25622187, 26052093, 26769849, 27791197, 27818144, 28404923, 29729098 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28543180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	19898489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28775790, 31578830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25559563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29348847		★★★★★ ★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	29484780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28314786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	25820558	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27813153, 29262817, 29619270, 29655696, 31487581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	16023795, 27808398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	17377523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30984279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36311708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	27813153, 31725199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22886393, 29436576, 30643010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35989576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36830707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26052093, 30673917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28024152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18474871, 30588107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23608757		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28470929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28598282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	28687809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	28687809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18752500, 25712341, 27869166, 28676490, 29202848, 31262711, 31712163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29202848, 33771884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28480979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29950522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	20953186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35238669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	28041965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	28323847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18759964, 21910999, 22231568, 22589256, 24886600, 25522907, 26782542, 28240593, 28506571, 29950522, 30506403		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20453842, 23143596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	22901274, 24701036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22901274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30446998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25605144	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24999832, 28789366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23794111, 24026882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24302991, 24999832, 29703234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24999832	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29463844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29193723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31061316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23013936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23013936	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35240920, 35851310, 38062041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28543180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	22656185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	28506571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22589256, 28470929		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21610143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	22231568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	19898489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40296903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35194034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30017935		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF6 (TNF receptor associated factor 6)