Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9450
Gene name	Lymphocyte antigen 86
Gene symbol	LY86
Synonyms (NCBI Gene)	MD-1MD1MMD-1dJ80N2.1
Chromosome	6
Chromosome location	6p25.1

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT1123049	hsa-miR-1207-3p	CLIP-seq
MIRT1123050	hsa-miR-28-5p	CLIP-seq
MIRT1123051	hsa-miR-3139	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT1123053	hsa-miR-4279	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT1123060	hsa-miR-708	CLIP-seq
MIRT1123049	hsa-miR-1207-3p	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT2265243	hsa-miR-181a	CLIP-seq
MIRT2265244	hsa-miR-181b	CLIP-seq
MIRT2265245	hsa-miR-181c	CLIP-seq
MIRT2265246	hsa-miR-181d	CLIP-seq
MIRT1123050	hsa-miR-28-5p	CLIP-seq
MIRT1123051	hsa-miR-3139	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT2265247	hsa-miR-4262	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT2265248	hsa-miR-4652-5p	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT2265249	hsa-miR-542-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT1123060	hsa-miR-708	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	21857663, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IBA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IGI	10880523
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA

MIM	HGNC	e!Ensembl
605241	16837	ENSG00000112799

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	O95711
Protein name	Lymphocyte antigen 86 (Ly-86) (Protein MD-1)
Protein function	May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
PDB	3B2D
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Highly expressed in B-cells, monocytes and tonsil.
Sequence	MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Sequence length	162
Interactions	View interactions

Reactome Pathway
Toll Like Receptor 4 (TLR4) Cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (23)
BRAIN INJURIES	—	CTD	21549006	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	21335463	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	30804561, 37069358	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	25866641, 36539618	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394, 39406924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	21335463	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE DERMATOMYOSITIS	—	GWAS catalog	35094092	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	20038947	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	26545240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	25866641	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	28060188	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	28203683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (16)
Alzheimer Disease	Alzheimer disease	Pubtator	31280115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19255686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	37861500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31104313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	35586138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	18001295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24735745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37861500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24735745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24735745, 37063877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37063877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31104313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	21463476, 28203683	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

LY86 (lymphocyte antigen 86)

Bookmark This Gene