LUZP2 (leucine zipper protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 338645
• Gene name: Leucine zipper protein 2
• Gene symbol: LUZP2
• Synonyms (NCBI Gene): KFSP2566, PRO6246
• Chromosome: 11
• Chromosome location: 11p14.3
• Summary: This gene encodes a leucine zipper protein. This protein is deleted in some patients with Wilms tumor-Aniridia-Genitourinary anomalies-mental Retardation (WAGR) syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct

miRNA Show/Hide all (236)

miRTarBase ID	miRNA	Experiments	Reference
MIRT690016	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT690015	hsa-miR-4459	HITS-CLIP	23313552
MIRT690014	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT690013	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT690012	hsa-miR-544b	HITS-CLIP	23313552
MIRT690011	hsa-miR-6078	HITS-CLIP	23313552
MIRT690010	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT690009	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT690008	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT690007	hsa-miR-3926	HITS-CLIP	23313552
MIRT690006	hsa-miR-3165	HITS-CLIP	23313552
MIRT690005	hsa-miR-548s	HITS-CLIP	23313552
MIRT549831	hsa-miR-3609	PAR-CLIP	21572407
MIRT549830	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT549829	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT549828	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT549827	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT549826	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT549825	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT549824	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT549823	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT549822	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT549821	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT549820	hsa-miR-652-5p	PAR-CLIP	21572407
MIRT549819	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT549818	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT549817	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT549816	hsa-miR-5692b	PAR-CLIP	21572407
MIRT549815	hsa-miR-5692c	PAR-CLIP	21572407
MIRT549814	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT549813	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT549812	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT549811	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT549810	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT690009	hsa-miR-3190-5p	PAR-CLIP	27292025
MIRT690007	hsa-miR-3926	PAR-CLIP	27292025
MIRT690008	hsa-miR-4786-5p	PAR-CLIP	27292025
MIRT690005	hsa-miR-548s	PAR-CLIP	27292025
MIRT690013	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT690016	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT690015	hsa-miR-4459	HITS-CLIP	23313552
MIRT690014	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT690013	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT690012	hsa-miR-544b	HITS-CLIP	23313552
MIRT690011	hsa-miR-6078	HITS-CLIP	23313552
MIRT690010	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT690009	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT690008	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT690007	hsa-miR-3926	HITS-CLIP	23313552
MIRT690006	hsa-miR-3165	HITS-CLIP	23313552
MIRT690005	hsa-miR-548s	HITS-CLIP	23313552
MIRT549831	hsa-miR-3609	PAR-CLIP	21572407
MIRT549830	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT549829	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT549828	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT549827	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT549826	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT549825	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT549824	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT549823	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT549822	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT549821	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT549820	hsa-miR-652-5p	PAR-CLIP	21572407
MIRT549819	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT549818	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT549817	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT549816	hsa-miR-5692b	PAR-CLIP	21572407
MIRT549815	hsa-miR-5692c	PAR-CLIP	21572407
MIRT549814	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT549813	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT549812	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT549811	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT549810	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT1122590	hsa-miR-1228	CLIP-seq
MIRT1122591	hsa-miR-1297	CLIP-seq
MIRT1122592	hsa-miR-1298	CLIP-seq
MIRT1122593	hsa-miR-146a	CLIP-seq
MIRT1122594	hsa-miR-146b-5p	CLIP-seq
MIRT1122595	hsa-miR-155	CLIP-seq
MIRT1122596	hsa-miR-181a	CLIP-seq
MIRT1122597	hsa-miR-181b	CLIP-seq
MIRT1122598	hsa-miR-181c	CLIP-seq
MIRT1122599	hsa-miR-181d	CLIP-seq
MIRT1122600	hsa-miR-1915	CLIP-seq
MIRT1122601	hsa-miR-193a-3p	CLIP-seq
MIRT1122602	hsa-miR-193b	CLIP-seq
MIRT1122603	hsa-miR-24	CLIP-seq
MIRT1122604	hsa-miR-26a	CLIP-seq
MIRT1122605	hsa-miR-26b	CLIP-seq
MIRT1122606	hsa-miR-3163	CLIP-seq
MIRT1122607	hsa-miR-342-3p	CLIP-seq
MIRT1122608	hsa-miR-3622a-5p	CLIP-seq
MIRT1122609	hsa-miR-3646	CLIP-seq
MIRT1122610	hsa-miR-3665	CLIP-seq
MIRT1122611	hsa-miR-3689d	CLIP-seq
MIRT1122612	hsa-miR-376a	CLIP-seq
MIRT1122613	hsa-miR-376b	CLIP-seq
MIRT1122614	hsa-miR-3914	CLIP-seq
MIRT1122615	hsa-miR-4251	CLIP-seq
MIRT1122616	hsa-miR-4262	CLIP-seq
MIRT1122617	hsa-miR-4269	CLIP-seq
MIRT1122618	hsa-miR-4284	CLIP-seq
MIRT1122619	hsa-miR-4433	CLIP-seq
MIRT1122620	hsa-miR-4435	CLIP-seq
MIRT1122621	hsa-miR-4465	CLIP-seq
MIRT1122622	hsa-miR-4499	CLIP-seq
MIRT1122623	hsa-miR-4645-5p	CLIP-seq
MIRT1122624	hsa-miR-4673	CLIP-seq
MIRT1122625	hsa-miR-4719	CLIP-seq
MIRT1122626	hsa-miR-4724-5p	CLIP-seq
MIRT1122627	hsa-miR-4736	CLIP-seq
MIRT1122628	hsa-miR-4755-3p	CLIP-seq
MIRT1122629	hsa-miR-4773	CLIP-seq
MIRT1122630	hsa-miR-4803	CLIP-seq
MIRT1122631	hsa-miR-513b	CLIP-seq
MIRT1122632	hsa-miR-548a-3p	CLIP-seq
MIRT1122633	hsa-miR-548e	CLIP-seq
MIRT1122634	hsa-miR-548f	CLIP-seq
MIRT1122635	hsa-miR-564	CLIP-seq
MIRT1122636	hsa-miR-586	CLIP-seq
MIRT1122637	hsa-miR-589	CLIP-seq
MIRT1122638	hsa-miR-603	CLIP-seq
MIRT1122639	hsa-miR-642b	CLIP-seq
MIRT1122640	hsa-miR-651	CLIP-seq
MIRT1122619	hsa-miR-4433	CLIP-seq
MIRT1122625	hsa-miR-4719	CLIP-seq
MIRT1122590	hsa-miR-1228	CLIP-seq
MIRT2034636	hsa-miR-144	CLIP-seq
MIRT1122593	hsa-miR-146a	CLIP-seq
MIRT1122594	hsa-miR-146b-5p	CLIP-seq
MIRT2034637	hsa-miR-1827	CLIP-seq
MIRT1122601	hsa-miR-193a-3p	CLIP-seq
MIRT1122602	hsa-miR-193b	CLIP-seq
MIRT1122603	hsa-miR-24	CLIP-seq
MIRT1122607	hsa-miR-342-3p	CLIP-seq
MIRT1122608	hsa-miR-3622a-5p	CLIP-seq
MIRT1122610	hsa-miR-3665	CLIP-seq
MIRT1122615	hsa-miR-4251	CLIP-seq
MIRT1122617	hsa-miR-4269	CLIP-seq
MIRT1122618	hsa-miR-4284	CLIP-seq
MIRT1122619	hsa-miR-4433	CLIP-seq
MIRT1122620	hsa-miR-4435	CLIP-seq
MIRT1122622	hsa-miR-4499	CLIP-seq
MIRT1122623	hsa-miR-4645-5p	CLIP-seq
MIRT2034638	hsa-miR-4649-3p	CLIP-seq
MIRT1122624	hsa-miR-4673	CLIP-seq
MIRT1122627	hsa-miR-4736	CLIP-seq
MIRT1122628	hsa-miR-4755-3p	CLIP-seq
MIRT1122635	hsa-miR-564	CLIP-seq
MIRT1122637	hsa-miR-589	CLIP-seq
MIRT2034639	hsa-miR-940	CLIP-seq
MIRT2265201	hsa-miR-1179	CLIP-seq
MIRT2265202	hsa-miR-1207-5p	CLIP-seq
MIRT2265203	hsa-miR-1272	CLIP-seq
MIRT2265204	hsa-miR-1273g	CLIP-seq
MIRT1122592	hsa-miR-1298	CLIP-seq
MIRT2265205	hsa-miR-1322	CLIP-seq
MIRT1122593	hsa-miR-146a	CLIP-seq
MIRT1122594	hsa-miR-146b-5p	CLIP-seq
MIRT2265206	hsa-miR-153	CLIP-seq
MIRT2034637	hsa-miR-1827	CLIP-seq
MIRT1122610	hsa-miR-3665	CLIP-seq
MIRT2265207	hsa-miR-3938	CLIP-seq
MIRT1122615	hsa-miR-4251	CLIP-seq
MIRT2265208	hsa-miR-4263	CLIP-seq
MIRT2265209	hsa-miR-4289	CLIP-seq
MIRT2265210	hsa-miR-4310	CLIP-seq
MIRT1122619	hsa-miR-4433	CLIP-seq
MIRT2265211	hsa-miR-4436b-5p	CLIP-seq
MIRT2265212	hsa-miR-448	CLIP-seq
MIRT2265213	hsa-miR-4659a-3p	CLIP-seq
MIRT2265214	hsa-miR-4659b-3p	CLIP-seq
MIRT2265215	hsa-miR-4763-3p	CLIP-seq
MIRT2265216	hsa-miR-514	CLIP-seq
MIRT2265217	hsa-miR-514b-3p	CLIP-seq
MIRT1122637	hsa-miR-589	CLIP-seq
MIRT2265218	hsa-miR-890	CLIP-seq
MIRT2034639	hsa-miR-940	CLIP-seq
MIRT1122619	hsa-miR-4433	CLIP-seq
MIRT1122627	hsa-miR-4736	CLIP-seq
MIRT2265202	hsa-miR-1207-5p	CLIP-seq
MIRT1122595	hsa-miR-155	CLIP-seq
MIRT2034637	hsa-miR-1827	CLIP-seq
MIRT2453514	hsa-miR-34b	CLIP-seq
MIRT2453515	hsa-miR-3614-5p	CLIP-seq
MIRT1122614	hsa-miR-3914	CLIP-seq
MIRT2453516	hsa-miR-4270	CLIP-seq
MIRT2453517	hsa-miR-4441	CLIP-seq
MIRT2453518	hsa-miR-4646-5p	CLIP-seq
MIRT2453519	hsa-miR-4747-5p	CLIP-seq
MIRT2265215	hsa-miR-4763-3p	CLIP-seq
MIRT2453520	hsa-miR-490-3p	CLIP-seq
MIRT1122636	hsa-miR-586	CLIP-seq
MIRT1122640	hsa-miR-651	CLIP-seq
MIRT2034639	hsa-miR-940	CLIP-seq
MIRT2265202	hsa-miR-1207-5p	CLIP-seq
MIRT2034637	hsa-miR-1827	CLIP-seq
MIRT1122606	hsa-miR-3163	CLIP-seq
MIRT2453514	hsa-miR-34b	CLIP-seq
MIRT2453515	hsa-miR-3614-5p	CLIP-seq
MIRT2265208	hsa-miR-4263	CLIP-seq
MIRT2453516	hsa-miR-4270	CLIP-seq
MIRT2453517	hsa-miR-4441	CLIP-seq
MIRT2453518	hsa-miR-4646-5p	CLIP-seq
MIRT2564184	hsa-miR-4729	CLIP-seq
MIRT2564185	hsa-miR-4735-5p	CLIP-seq
MIRT2453519	hsa-miR-4747-5p	CLIP-seq
MIRT2265215	hsa-miR-4763-3p	CLIP-seq
MIRT2453520	hsa-miR-490-3p	CLIP-seq
MIRT2564186	hsa-miR-513a-3p	CLIP-seq
MIRT2564187	hsa-miR-576-5p	CLIP-seq
MIRT2034639	hsa-miR-940	CLIP-seq
MIRT2684320	hsa-miR-106a	CLIP-seq
MIRT2684321	hsa-miR-106b	CLIP-seq
MIRT2265202	hsa-miR-1207-5p	CLIP-seq
MIRT2684322	hsa-miR-1252	CLIP-seq
MIRT2684323	hsa-miR-17	CLIP-seq
MIRT2034637	hsa-miR-1827	CLIP-seq
MIRT2684324	hsa-miR-20a	CLIP-seq
MIRT2684325	hsa-miR-20b	CLIP-seq
MIRT1122606	hsa-miR-3163	CLIP-seq
MIRT2453514	hsa-miR-34b	CLIP-seq
MIRT2453515	hsa-miR-3614-5p	CLIP-seq
MIRT2684326	hsa-miR-374a	CLIP-seq
MIRT2684327	hsa-miR-374b	CLIP-seq
MIRT2453516	hsa-miR-4270	CLIP-seq
MIRT2453517	hsa-miR-4441	CLIP-seq
MIRT2684328	hsa-miR-4517	CLIP-seq
MIRT2453518	hsa-miR-4646-5p	CLIP-seq
MIRT2265215	hsa-miR-4763-3p	CLIP-seq
MIRT2453520	hsa-miR-490-3p	CLIP-seq
MIRT2684329	hsa-miR-519d	CLIP-seq
MIRT2684330	hsa-miR-548ah	CLIP-seq
MIRT2684331	hsa-miR-653	CLIP-seq
MIRT2684332	hsa-miR-93	CLIP-seq
MIRT2034639	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA

Other IDs

• MIM: 608178
• HGNC: 23206
• e!Ensembl: ENSG00000187398

Protein

• UniProt ID: Q86TE4
• Protein name: Leucine zipper protein 2
• Sequence:

  MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQ
  SLKNDEQSAKTDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVE
  RKSKMIRDLQNENKSLKNKLLSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTD
  LEQKLAVAKNELEKAALDRESQMKAMKETVQLCLTSVFRDQPPPPLSLITSNPTRMLLPP
  RNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTTACDSQDEGRPCSMKHKESPP
  SNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL

• Sequence length: 346

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (23)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	22881374, 34743297, 35589863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	GWAS catalog	34985809	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	32747698	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	30801121	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	34985809	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALDOSTERONISM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	22881374	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30643256, 37464041, 38177345	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	33762635	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	20852632	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	20852632	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	27082954	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	33762635, 34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR BRAIN INJURY	—	GWAS catalog	25188341	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	22881374, 29747637	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	22881374		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	22881374		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27221037		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	12856284		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25772781	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36124532, 37245085	Associate	★☆☆☆☆ Found in Text Mining only
WAGR Syndrome	WAGR Syndrome	BEFREE	12856284		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RASSF10 2 shared diseasesPeripheral arterial disease, Vascular brain injury 2 shared evidence sourcesGWAS catalog (Peripheral arterial disease), GWAS catalog (Vascular brain injury) Related via 2 shared diseases including Peripheral arterial disease, Vascular brain injury — evidence mostly GWAS catalog. BMAL1 2 shared diseasesPeripheral arterial disease, Vascular brain injury 2 shared evidence sourcesGWAS catalog (Peripheral arterial disease), GWAS catalog (Vascular brain injury) Related via 2 shared diseases including Peripheral arterial disease, Vascular brain injury — evidence mostly GWAS catalog. RBFOX1 2 shared diseasesPeripheral arterial disease, Vascular brain injury 2 shared evidence sourcesGWAS catalog (Peripheral arterial disease), GWAS catalog (Vascular brain injury) Related via 2 shared diseases including Peripheral arterial disease, Vascular brain injury — evidence mostly GWAS catalog. HLA-DRB1 2 shared diseasesNasal polyp, Peripheral arterial disease 2 shared evidence sourcesGWAS catalog (Nasal polyp), GWAS catalog (Peripheral arterial disease) Related via 2 shared diseases including Nasal polyp, Peripheral arterial disease — evidence mostly GWAS catalog. HLA-DQA1 2 shared diseasesNasal polyp, Peripheral arterial disease 2 shared evidence sourcesGWAS catalog (Nasal polyp), GWAS catalog (Peripheral arterial disease) Related via 2 shared diseases including Nasal polyp, Peripheral arterial disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RASSF10	2	["Peripheral arterial disease","Vascular brain injury"]	0	[]	2	["GWAS catalog (Peripheral arterial disease)","GWAS catalog (Vascular brain injury)"]
BMAL1	2	["Peripheral arterial disease","Vascular brain injury"]	0	[]	2	["GWAS catalog (Peripheral arterial disease)","GWAS catalog (Vascular brain injury)"]
RBFOX1	2	["Peripheral arterial disease","Vascular brain injury"]	0	[]	2	["GWAS catalog (Peripheral arterial disease)","GWAS catalog (Vascular brain injury)"]
HLA-DRB1	2	["Nasal polyp","Peripheral arterial disease"]	0	[]	2	["GWAS catalog (Nasal polyp)","GWAS catalog (Peripheral arterial disease)"]
HLA-DQA1	2	["Nasal polyp","Peripheral arterial disease"]	0	[]	2	["GWAS catalog (Nasal polyp)","GWAS catalog (Peripheral arterial disease)"]

Diseases Linked via Similar Genes

Obstructive pulmonary disease Linked via 4 of 5 related genesRASSF10, BMAL1, RBFOX1, HLA-DQA1 Multiple sclerosis Linked via 4 of 5 related genesRASSF10, BMAL1, HLA-DRB1, HLA-DQA1 Breast cancer Linked via 4 of 5 related genesBMAL1, RBFOX1, HLA-DRB1, HLA-DQA1 Metabolic syndrome Linked via 4 of 5 related genesBMAL1, RBFOX1, HLA-DRB1, HLA-DQA1 Diabetes mellitus type 2 Linked via 4 of 5 related genesBMAL1, RBFOX1, HLA-DRB1, HLA-DQA1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obstructive pulmonary disease	4	["RASSF10","BMAL1","RBFOX1","HLA-DQA1"]
Multiple sclerosis	4	["RASSF10","BMAL1","HLA-DRB1","HLA-DQA1"]
Breast cancer	4	["BMAL1","RBFOX1","HLA-DRB1","HLA-DQA1"]
Metabolic syndrome	4	["BMAL1","RBFOX1","HLA-DRB1","HLA-DQA1"]
Diabetes mellitus type 2	4	["BMAL1","RBFOX1","HLA-DRB1","HLA-DQA1"]