LRATD1 (LRAT domain containing 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 151354
Gene name LRAT domain containing 1
Gene symbol LRATD1
Synonyms (NCBI Gene)
FAM84ANSE1PP11517
Chromosome 2
Chromosome location 2p24.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0000902 Process Cell morphogenesis IMP 16820875
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0048870 Process Cell motility IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611234 20743 ENSG00000162981
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KN4
Protein name Protein LRATD1 (LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)
Protein function May play a role in cell morphology and motility.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04970 LRAT 118 → 225 Lecithin retinol acyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.
Sequence 
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPG
CTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALC
EPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNS
WYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQ
QQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Sequence length 292
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (15)
Phenotype Name Clinical Significance Source Reference Evidence Score
BIPOLAR DISORDER — GWAS catalog 34099189
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC GRAFT VERSUS HOST DISEASE — GWAS catalog 34996099
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOMA — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER — GWAS catalog 34099189
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (15)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 21424122
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 21424122
★★★★★
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Ischemic stroke Pubtator 37370144 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 16820875
★★★★★
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic Neoplasms LHGDN 16820875
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver neoplasms Liver neoplasms BEFREE 21424122
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of liver Liver Cancer BEFREE 21424122
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 18446232
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 18446232
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant tumor of colon Colonic Neoplasms BEFREE 16820875
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
NBAS 4 shared diseasesMale reproductive organ cancer, Obstructive sleep apnea syndrome, Psychiatric disorders, Willis-ekbom disease 4 shared evidence sourcesGWAS catalog (Male reproductive organ cancer), GWAS catalog (Obstructive sleep apnea syndrome), GWAS catalog (Psychiatric disorders), GWAS catalog (Willis-ekbom disease) Related via 4 shared diseases including Male reproductive organ cancer, Obstructive sleep apnea syndrome — evidence mostly GWAS catalog. IL34 2 shared diseasesPolycystic ovary syndrome, Psychiatric disorders 3 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Polycystic ovary syndrome, Psychiatric disorders — evidence mostly CTD. TMEM132B 2 shared diseasesObstructive sleep apnea syndrome, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Obstructive sleep apnea syndrome), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Obstructive sleep apnea syndrome, Psychiatric disorders — evidence mostly GWAS catalog. DUSP16 2 shared diseasesPsychiatric disorders, Willis-ekbom disease 2 shared evidence sourcesGWAS catalog (Psychiatric disorders), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Psychiatric disorders, Willis-ekbom disease — evidence mostly GWAS catalog. IGSF11 2 shared diseasesPsychiatric disorders, Willis-ekbom disease 2 shared evidence sourcesGWAS catalog (Psychiatric disorders), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Psychiatric disorders, Willis-ekbom disease — evidence mostly GWAS catalog.
Alzheimer disease Linked via 4 of 5 related genesNBAS, IL34, TMEM132B, IGSF11 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesTMEM132B, IGSF11 Dementia Linked via 2 of 5 related genesTMEM132B, IGSF11 Substance abuse Linked via 2 of 5 related genesTMEM132B, IGSF11 Bone fragility with contractures, arterial rupture, and deafness Linked via 1 of 5 related genesNBAS