LPAR2 (lysophosphatidic acid receptor 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9170
• Gene name: Lysophosphatidic acid receptor 2
• Gene symbol: LPAR2
• Synonyms (NCBI Gene): EDG-4, EDG4, LPA-2, LPA2
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This gene encodes a member of family I of the G protein-coupled receptors, as well as the EDG family of proteins. This protein functions as a lysophosphatidic acid (LPA) receptor and contributes to Ca2+ mobilization, a critical cellular response to LPA in

miRNA Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656688	hsa-miR-4324	HITS-CLIP	23824327
MIRT656689	hsa-miR-544b	HITS-CLIP	23824327
MIRT656686	hsa-miR-6720-3p	HITS-CLIP	23824327
MIRT656687	hsa-miR-564	HITS-CLIP	23824327
MIRT656685	hsa-miR-1200	HITS-CLIP	23824327
MIRT486032	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT486031	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT486030	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT486029	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT486028	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT486027	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT486026	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT486025	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT486024	hsa-miR-302a-3p	PAR-CLIP	23592263
MIRT486023	hsa-miR-302b-3p	PAR-CLIP	23592263
MIRT486022	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT486021	hsa-miR-302d-3p	PAR-CLIP	23592263
MIRT486020	hsa-miR-302e	PAR-CLIP	23592263
MIRT486019	hsa-miR-372-3p	PAR-CLIP	23592263
MIRT486018	hsa-miR-373-3p	PAR-CLIP	23592263
MIRT486017	hsa-miR-520a-3p	PAR-CLIP	23592263
MIRT486016	hsa-miR-520b	PAR-CLIP	23592263
MIRT486015	hsa-miR-520c-3p	PAR-CLIP	23592263
MIRT486014	hsa-miR-520d-3p	PAR-CLIP	23592263
MIRT486013	hsa-miR-520e	PAR-CLIP	23592263
MIRT486012	hsa-miR-6895-5p	PAR-CLIP	23592263
MIRT486011	hsa-miR-3973	PAR-CLIP	23592263
MIRT486010	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT486009	hsa-miR-520h	PAR-CLIP	23592263
MIRT486008	hsa-miR-3918	PAR-CLIP	23592263
MIRT486007	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT486005	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT486006	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT486004	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT656688	hsa-miR-4324	HITS-CLIP	23824327
MIRT656689	hsa-miR-544b	HITS-CLIP	23824327
MIRT656686	hsa-miR-6720-3p	HITS-CLIP	23824327
MIRT656687	hsa-miR-564	HITS-CLIP	23824327
MIRT656685	hsa-miR-1200	HITS-CLIP	23824327
MIRT486032	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT486031	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT486030	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT486029	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT486028	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT486027	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT486026	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT486025	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT486024	hsa-miR-302a-3p	PAR-CLIP	23592263
MIRT486023	hsa-miR-302b-3p	PAR-CLIP	23592263
MIRT486022	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT486021	hsa-miR-302d-3p	PAR-CLIP	23592263
MIRT486020	hsa-miR-302e	PAR-CLIP	23592263
MIRT486019	hsa-miR-372-3p	PAR-CLIP	23592263
MIRT486018	hsa-miR-373-3p	PAR-CLIP	23592263
MIRT486017	hsa-miR-520a-3p	PAR-CLIP	23592263
MIRT486016	hsa-miR-520b	PAR-CLIP	23592263
MIRT486015	hsa-miR-520c-3p	PAR-CLIP	23592263
MIRT486014	hsa-miR-520d-3p	PAR-CLIP	23592263
MIRT486013	hsa-miR-520e	PAR-CLIP	23592263
MIRT486012	hsa-miR-6895-5p	PAR-CLIP	23592263
MIRT486011	hsa-miR-3973	PAR-CLIP	23592263
MIRT486010	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT486009	hsa-miR-520h	PAR-CLIP	23592263
MIRT486008	hsa-miR-3918	PAR-CLIP	23592263
MIRT486007	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT486005	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT486006	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT486004	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT1115449	hsa-miR-1254	CLIP-seq
MIRT1115450	hsa-miR-2276	CLIP-seq
MIRT1115451	hsa-miR-3116	CLIP-seq
MIRT1115452	hsa-miR-3150a-3p	CLIP-seq
MIRT1115453	hsa-miR-3175	CLIP-seq
MIRT1115454	hsa-miR-342-3p	CLIP-seq
MIRT1115455	hsa-miR-3650	CLIP-seq
MIRT1115456	hsa-miR-3691-5p	CLIP-seq
MIRT1115457	hsa-miR-4267	CLIP-seq
MIRT1115458	hsa-miR-4667-5p	CLIP-seq
MIRT1115459	hsa-miR-4675	CLIP-seq
MIRT1115460	hsa-miR-4700-5p	CLIP-seq
MIRT1115461	hsa-miR-4708-3p	CLIP-seq
MIRT1115462	hsa-miR-4741	CLIP-seq
MIRT1115463	hsa-miR-4752	CLIP-seq
MIRT1115464	hsa-miR-485-5p	CLIP-seq
MIRT1115465	hsa-miR-550a	CLIP-seq
MIRT1115466	hsa-miR-661	CLIP-seq
MIRT1115467	hsa-miR-759	CLIP-seq
MIRT1115468	hsa-miR-939	CLIP-seq
MIRT2263000	hsa-miR-1224-3p	CLIP-seq
MIRT2263001	hsa-miR-186	CLIP-seq
MIRT2263002	hsa-miR-4310	CLIP-seq
MIRT2263003	hsa-miR-548aa	CLIP-seq
MIRT2562497	hsa-miR-3074-5p	CLIP-seq
MIRT2562498	hsa-miR-3130-3p	CLIP-seq
MIRT2562499	hsa-miR-345	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SNAI2	Repression	17671192

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9525886
GO:0005515	Function	Protein binding	IPI	14688263, 16203867, 19306925, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9525886
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9804623
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9525886
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9804623
GO:0008289	Function	Lipid binding	IEA
GO:0008289	Function	Lipid binding	TAS	9525886
GO:0009986	Component	Cell surface	IDA	19306925
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030139	Component	Endocytic vesicle	IDA	19306925
GO:0030165	Function	PDZ domain binding	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0070915	Function	Lysophosphatidic acid receptor activity	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 605110
• HGNC: 3168
• e!Ensembl: ENSG00000064547

Protein

• UniProt ID: Q9HBW0
• Protein name: Lysophosphatidic acid receptor 2 (LPA receptor 2) (LPA-2) (Lysophosphatidic acid receptor Edg-4)
• Protein function: Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Plays a key role in phospholipase C-beta (PLC-beta) signaling pa
• PDB: 4P0C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	49 → 295	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed most abundantly in testes and peripheral blood leukocytes with less expression in pancreas, spleen, thymus and prostate. Little or no expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney, ovary, small in
• Sequence:

  MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
  RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
  TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
  MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
  KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
  EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL

• Sequence length: 351

Pathways

KEGG Pathway	Reactome Pathway
Rap1 signaling pathway	G alpha (q) signalling events
Phospholipase D signaling pathway	G alpha (i) signalling events
Neuroactive ligand-receptor interaction	Lysosphingolipid and LPA receptors
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Pathways in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (226)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrodysostosis	Acrodysostosis	BEFREE	22723333, 23043190		★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8702478		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27588474, 28428987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29971639		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28653505		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	11027943, 29393391		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19247167, 30576947		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22354754	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11728229, 15764725, 15947423, 17154652, 18588753, 20705147, 21392828, 28754608, 30335499		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	38375886	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21499268, 22897819, 28912643, 28948080		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12086852, 25293589, 25354317, 30409535, 30510193, 30827936		★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypocalcemia	Hypocalcemia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Bartter Disease	Bartter syndrome	BEFREE	27339034		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18386288		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	21234797	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29949238		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11897506, 15535846, 16397244, 19584257, 19609003, 19622769, 23500535, 24599592, 26985934, 27805252, 28209621, 30760632, 31035435, 9367686		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15535846, 17496233, 31035435, 37372960	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19609003	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	30670596		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15535846, 35857125	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35241179	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25209561		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	15535846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27583415, 31514484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22715397, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19331211	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35241179, 35857125	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25172843		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10537322, 17204312, 17442564, 19001604, 19010824, 19331211, 27809800		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26248277, 29166798, 29848777, 31236974		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21964883		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21964883		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	25001852		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31785110		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21936770		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28877377, 30811196		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31132237		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12670925, 17544220, 20979106, 21134377, 29971639		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15728708		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21134377		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15220934, 25701758, 26937138, 28875496		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15220934, 15728708, 15837931, 17430902, 26352431, 26937138, 33959968	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17544220	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974, 31785110		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28870781		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23969937		★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	21234797	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	16687567, 16926383, 17028442, 18161478, 21467199		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27471203		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22354754		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	26576537		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21392828		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21392828, 28358422		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19476565		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18037923, 20816753, 23226241, 24946790, 28105282, 28363772, 28734639, 29466332, 29684031, 30154102		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	11291053, 12107237		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	19331211	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	19331211		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	23268337	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16239258, 19019417, 23235274, 26327335, 29182028		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29182028, 29328374	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29621954		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23458722		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	26854024		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17204312, 17442564, 19331211		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	25732908		★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	20846291		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25246029	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25246029, 28233865		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30093116		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31235682		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17611713, 21503828, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28051998	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17611713, 21503828, 21900396, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18991757, 30638950		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23039881		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30541874		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	10087195		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	8001158		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20708032, 8626439		★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis, Non-Immune	Hydrops Fetalis	BEFREE	30115739		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28338186		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29022064		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15225142, 16439609, 16481879, 18370232, 25150869, 28412414, 30075183		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29669745		★☆☆☆☆ Found in Text Mining only
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	15598687, 17164310		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	30975883		★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 8	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	15598687		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27124742		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	15535846		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31272268		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25937634		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	18285834, 24830383		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10364352, 10438939, 10662620, 11289142, 11418689, 11504542, 12620408, 15003988, 16904612, 17329974, 17483315, 17881360, 18802460, 19915163, 20213674, 20660728, 20818438, 21159881, 21559457, 22942256, 23269549, 24292677, 28161489, 30308321, 31838186, 8892957		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28596381, 30305310		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35857125	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15097244		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15143072		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15039279, 26220344, 28428987, 30223538, 31032748		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17259344, 27583415, 29704239, 30061721		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25246029	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17259344		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25640674, 28273093		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19138979, 20686609, 28653505		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31235682	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8892957		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20493668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11897506, 15535846, 16397244, 19584257, 19609003, 22927430, 23500535, 24599592, 26985934, 27805252, 30760632, 31035435, 9367686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16239258, 19019417, 23235274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22715397, 25744720, 26462152, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10537322, 19001604, 19010824, 27809800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19129242, 23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 28768769, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15650023, 17130136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11832457, 12668280, 12759391, 15492257, 17188489, 19726788, 19755124, 21084381, 21159881, 22942256, 23269549, 23497290, 23500535, 24508914, 24599592, 25970609, 26854063, 26893368, 27601164, 27715394, 28223438, 28618224, 28673732, 29165389, 29268141, 29483837, 29614094, 29921886, 30510193, 30559168, 30775647, 31496800, 31500846, 31630880, 31659944, 31787357		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21964883		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12670925, 17544220, 20979106, 21134377, 29971639		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15535846, 17496233		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	38627262	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15322701, 18583061, 19338054, 22273393, 28223438, 30267482		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27046448		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25364818		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18754873	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25246581, 27215467, 28691227, 29655980		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	27583415	Stimulate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28229904		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	30482667		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22591013		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28052250, 30131588		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28412414, 28798316		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11289142, 12150333, 12620408, 17894856, 19001604, 20480410, 20855608, 21102457, 21385899, 21559457, 21964883, 22942256, 23269549, 23651229, 23979133, 24853422, 24882516, 25174588, 25194819, 25434383, 25701758, 27248167, 27805252, 28152577, 29704239, 29749524, 31168089, 9284742		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	12824183		★☆☆☆☆ Found in Text Mining only
Nephrogenic Syndrome of Inappropriate Antidiuresis	Nephrogenic Syndrome Of Inappropriate Antidiuresis	BEFREE	31486901		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31025859		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21299846		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23144692, 27669169		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10903341, 18037923, 20462274, 24946790, 25970609, 31002796, 31288724		★☆☆☆☆ Found in Text Mining only
Ocular albinism, type I	Ocular albinism	BEFREE	16646960, 31275171		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28673732, 29277692, 30975883		★☆☆☆☆ Found in Text Mining only
Osteoporosis Postmenopausal	Osteoporosis	Pubtator	15535846	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29859140		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31850493	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10537322, 10729222, 19001604, 19010824, 27809800		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12759391, 19001604		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15728708, 18461672, 19116446, 26476080	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19129242, 23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26941397, 31455351		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	27760455		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30993114		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	22333914, 23754170		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27588474		★☆☆☆☆ Found in Text Mining only
Priapism	Priapism	BEFREE	29394072		★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11593396		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19025891		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	BEFREE	29387507		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	11858796		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23808384		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27297948		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25216639		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	19955366, 27694816		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11247813, 8889552		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10094932, 15225142, 22354754		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	20660728	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	21784156		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20158934, 21784156, 28763059, 29497362, 30710087, 31704949		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	21618827		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30503722		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	15274044		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35241179	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18057535		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24568968		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25246029, 28233865		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23344946		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30106120, 31115486, 31235682, 36551233	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29025761		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31455351	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18451066		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	15225142		★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24599592		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30872391		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31235682	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18719078, 27089179, 28223438, 30352874		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30586762		★☆☆☆☆ Found in Text Mining only
Vibratory urticaria	Vibratory urticaria	BEFREE	29454835		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 1	von Willebrand disorder	BEFREE	26630678		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	26092770	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LPAR5 7 shared pathwaysRap1 signaling pathway, Phospholipase D signaling pathway, Regulation of actin cytoskeleton, Pathogenic Escherichia coli infection, G alpha (i) signalling events, G alpha (q) signalling events, Lysosphingolipid and LPA receptors Related via 7 shared pathways including Rap1 signaling pathway, Phospholipase D signaling pathway. LPAR1 7 shared pathwaysRap1 signaling pathway, Phospholipase D signaling pathway, Regulation of actin cytoskeleton, Pathogenic Escherichia coli infection, G alpha (i) signalling events, G alpha (q) signalling events, Lysosphingolipid and LPA receptors Related via 7 shared pathways including Rap1 signaling pathway, Phospholipase D signaling pathway. LPAR3 5 shared pathwaysRap1 signaling pathway, Phospholipase D signaling pathway, G alpha (i) signalling events, G alpha (q) signalling events, Lysosphingolipid and LPA receptors Related via 5 shared pathways including Rap1 signaling pathway, Phospholipase D signaling pathway. LPAR4 5 shared pathwaysRap1 signaling pathway, Phospholipase D signaling pathway, Regulation of actin cytoskeleton, Pathogenic Escherichia coli infection, G alpha (q) signalling events Related via 5 shared pathways including Rap1 signaling pathway, Phospholipase D signaling pathway. F2R 5 shared pathwaysRap1 signaling pathway, Phospholipase D signaling pathway, Regulation of actin cytoskeleton, Pathogenic Escherichia coli infection, G alpha (q) signalling events Related via 5 shared pathways including Rap1 signaling pathway, Phospholipase D signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LPAR5	0	[]	7	["Rap1 signaling pathway","Phospholipase D signaling pathway","Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","G alpha (i) signalling events","G alpha (q) signalling events","Lysosphingolipid and LPA receptors"]	0	[]
LPAR1	0	[]	7	["Rap1 signaling pathway","Phospholipase D signaling pathway","Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","G alpha (i) signalling events","G alpha (q) signalling events","Lysosphingolipid and LPA receptors"]	0	[]
LPAR3	0	[]	5	["Rap1 signaling pathway","Phospholipase D signaling pathway","G alpha (i) signalling events","G alpha (q) signalling events","Lysosphingolipid and LPA receptors"]	0	[]
LPAR4	0	[]	5	["Rap1 signaling pathway","Phospholipase D signaling pathway","Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","G alpha (q) signalling events"]	0	[]
F2R	0	[]	5	["Rap1 signaling pathway","Phospholipase D signaling pathway","Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","G alpha (q) signalling events"]	0	[]

Diseases Linked via Similar Genes

Willis-ekbom disease Linked via 1 of 5 related genesLPAR5 Breast neoplasms Linked via 1 of 5 related genesLPAR1 Color vision deficiency Linked via 1 of 5 related genesLPAR1 Colorectal adenoma Linked via 1 of 5 related genesLPAR1 Colorectal cancer Linked via 1 of 5 related genesLPAR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Willis-ekbom disease	1	["LPAR5"]
Breast neoplasms	1	["LPAR1"]
Color vision deficiency	1	["LPAR1"]
Colorectal adenoma	1	["LPAR1"]
Colorectal cancer	1	["LPAR1"]