Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4012
Gene name	Leucyl and cystinyl aminopeptidase
Gene symbol	LNPEP
Synonyms (NCBI Gene)	CAPIRAPP-LAPPLAP
Chromosome	5
Chromosome location	5q15
Summary	This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-

319 Show/Hide all (319)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023791	hsa-miR-1-3p	Proteomics	18668040
MIRT044123	hsa-miR-30e-3p	CLASH	23622248
MIRT044081	hsa-miR-361-5p	CLASH	23622248
MIRT040837	hsa-miR-18a-3p	CLASH	23622248
MIRT037514	hsa-miR-744-5p	CLASH	23622248
MIRT037306	hsa-miR-877-5p	CLASH	23622248
MIRT608154	hsa-miR-8485	HITS-CLIP	22927820
MIRT608151	hsa-miR-603	HITS-CLIP	23313552
MIRT702245	hsa-miR-8080	HITS-CLIP	23313552
MIRT702244	hsa-miR-1197	HITS-CLIP	23313552
MIRT702243	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT702242	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT702241	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT493293	hsa-miR-4302	HITS-CLIP	23313552
MIRT702240	hsa-miR-1253	HITS-CLIP	23313552
MIRT702239	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT608154	hsa-miR-8485	HITS-CLIP	23824327
MIRT656708	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656707	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT656706	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT656705	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT656704	hsa-miR-4469	HITS-CLIP	23824327
MIRT656703	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT656702	hsa-miR-5705	HITS-CLIP	23824327
MIRT656701	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656700	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT656699	hsa-miR-6844	HITS-CLIP	23824327
MIRT608154	hsa-miR-8485	HITS-CLIP	23824327
MIRT608154	hsa-miR-8485	HITS-CLIP	24906430
MIRT608153	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT608152	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT608151	hsa-miR-603	HITS-CLIP	24906430
MIRT608150	hsa-miR-3941	HITS-CLIP	24906430
MIRT608154	hsa-miR-8485	HITS-CLIP	24906430
MIRT608153	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT608152	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT608151	hsa-miR-603	HITS-CLIP	24906430
MIRT608150	hsa-miR-3941	HITS-CLIP	24906430
MIRT511221	hsa-miR-138-5p	PAR-CLIP	20371350
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT511219	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT511217	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT511209	hsa-miR-6131	PAR-CLIP	20371350
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT511206	hsa-miR-548aw	PAR-CLIP	20371350
MIRT556446	hsa-miR-5692a	PAR-CLIP	21572407
MIRT556445	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT556444	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT556443	hsa-miR-636	PAR-CLIP	21572407
MIRT556442	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT522748	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT522747	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT522746	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT522745	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522744	hsa-miR-6783-5p	PAR-CLIP	23446348
MIRT511221	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT511219	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT511217	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT511209	hsa-miR-6131	PAR-CLIP	23446348
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	23446348
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT511206	hsa-miR-548aw	PAR-CLIP	23446348
MIRT493293	hsa-miR-4302	PAR-CLIP	23592263
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493289	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493288	hsa-miR-4451	PAR-CLIP	23592263
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	23592263
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	23592263
MIRT493285	hsa-miR-3689e	PAR-CLIP	23592263
MIRT493284	hsa-miR-3689f	PAR-CLIP	23592263
MIRT493282	hsa-miR-4689	PAR-CLIP	23592263
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT493285	hsa-miR-3689e	PAR-CLIP	26701625
MIRT493284	hsa-miR-3689f	PAR-CLIP	26701625
MIRT493289	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT493293	hsa-miR-4302	PAR-CLIP	26701625
MIRT493288	hsa-miR-4451	PAR-CLIP	26701625
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT493282	hsa-miR-4689	PAR-CLIP	26701625
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT576372	hsa-miR-8485	PAR-CLIP	27292025
MIRT608151	hsa-miR-603	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	22927820
MIRT608151	hsa-miR-603	HITS-CLIP	23313552
MIRT702245	hsa-miR-8080	HITS-CLIP	23313552
MIRT702244	hsa-miR-1197	HITS-CLIP	23313552
MIRT702243	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT702242	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT702241	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT493293	hsa-miR-4302	HITS-CLIP	23313552
MIRT702240	hsa-miR-1253	HITS-CLIP	23313552
MIRT702239	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT576372	hsa-miR-8485	HITS-CLIP	23824327
MIRT656708	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656707	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT656706	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT656705	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT656704	hsa-miR-4469	HITS-CLIP	23824327
MIRT656703	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT656702	hsa-miR-5705	HITS-CLIP	23824327
MIRT656701	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656700	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT656699	hsa-miR-6844	HITS-CLIP	23824327
MIRT576372	hsa-miR-8485	HITS-CLIP	23824327
MIRT511221	hsa-miR-138-5p	PAR-CLIP	20371350
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT511219	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT511217	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT511209	hsa-miR-6131	PAR-CLIP	20371350
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT511206	hsa-miR-548aw	PAR-CLIP	20371350
MIRT556446	hsa-miR-5692a	PAR-CLIP	21572407
MIRT556445	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT556444	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT556443	hsa-miR-636	PAR-CLIP	21572407
MIRT556442	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT522748	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT522747	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT522746	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT522745	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522744	hsa-miR-6783-5p	PAR-CLIP	23446348
MIRT511221	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT511219	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT511217	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT511209	hsa-miR-6131	PAR-CLIP	23446348
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	23446348
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT511206	hsa-miR-548aw	PAR-CLIP	23446348
MIRT493293	hsa-miR-4302	PAR-CLIP	23592263
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493289	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493288	hsa-miR-4451	PAR-CLIP	23592263
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	23592263
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	23592263
MIRT493285	hsa-miR-3689e	PAR-CLIP	23592263
MIRT493284	hsa-miR-3689f	PAR-CLIP	23592263
MIRT493282	hsa-miR-4689	PAR-CLIP	23592263
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT1112419	hsa-miR-1228	CLIP-seq
MIRT1112420	hsa-miR-130a	CLIP-seq
MIRT1112421	hsa-miR-130b	CLIP-seq
MIRT1112422	hsa-miR-140-3p	CLIP-seq
MIRT1112423	hsa-miR-19a	CLIP-seq
MIRT1112424	hsa-miR-19b	CLIP-seq
MIRT1112425	hsa-miR-2116	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT1112427	hsa-miR-301a	CLIP-seq
MIRT1112428	hsa-miR-301b	CLIP-seq
MIRT1112429	hsa-miR-3130-3p	CLIP-seq
MIRT1112430	hsa-miR-3145-5p	CLIP-seq
MIRT1112431	hsa-miR-3622a-3p	CLIP-seq
MIRT1112432	hsa-miR-3622b-3p	CLIP-seq
MIRT1112433	hsa-miR-3666	CLIP-seq
MIRT1112434	hsa-miR-4277	CLIP-seq
MIRT1112435	hsa-miR-4295	CLIP-seq
MIRT1112436	hsa-miR-454	CLIP-seq
MIRT1112437	hsa-miR-4793-3p	CLIP-seq
MIRT1112438	hsa-miR-544b	CLIP-seq
MIRT1112439	hsa-miR-582-5p	CLIP-seq
MIRT1112440	hsa-miR-600	CLIP-seq
MIRT1112419	hsa-miR-1228	CLIP-seq
MIRT1112441	hsa-miR-148a	CLIP-seq
MIRT1112442	hsa-miR-148b	CLIP-seq
MIRT1112443	hsa-miR-152	CLIP-seq
MIRT1112425	hsa-miR-2116	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT1112444	hsa-miR-29a	CLIP-seq
MIRT1112445	hsa-miR-29b	CLIP-seq
MIRT1112446	hsa-miR-29c	CLIP-seq
MIRT1112429	hsa-miR-3130-3p	CLIP-seq
MIRT1112447	hsa-miR-3137	CLIP-seq
MIRT1112448	hsa-miR-3148	CLIP-seq
MIRT1112431	hsa-miR-3622a-3p	CLIP-seq
MIRT1112432	hsa-miR-3622b-3p	CLIP-seq
MIRT1112449	hsa-miR-3973	CLIP-seq
MIRT1112434	hsa-miR-4277	CLIP-seq
MIRT1112437	hsa-miR-4793-3p	CLIP-seq
MIRT1112450	hsa-miR-4794	CLIP-seq
MIRT1112438	hsa-miR-544b	CLIP-seq
MIRT1112451	hsa-miR-548c-3p	CLIP-seq
MIRT1112439	hsa-miR-582-5p	CLIP-seq
MIRT1112440	hsa-miR-600	CLIP-seq
MIRT2031410	hsa-miR-125a-5p	CLIP-seq
MIRT2031411	hsa-miR-125b	CLIP-seq
MIRT2031412	hsa-miR-1291	CLIP-seq
MIRT1112420	hsa-miR-130a	CLIP-seq
MIRT1112421	hsa-miR-130b	CLIP-seq
MIRT2031413	hsa-miR-1972	CLIP-seq
MIRT1112423	hsa-miR-19a	CLIP-seq
MIRT1112424	hsa-miR-19b	CLIP-seq
MIRT1112427	hsa-miR-301a	CLIP-seq
MIRT1112428	hsa-miR-301b	CLIP-seq
MIRT1112430	hsa-miR-3145-5p	CLIP-seq
MIRT1112433	hsa-miR-3666	CLIP-seq
MIRT1112449	hsa-miR-3973	CLIP-seq
MIRT1112435	hsa-miR-4295	CLIP-seq
MIRT2031414	hsa-miR-4319	CLIP-seq
MIRT1112436	hsa-miR-454	CLIP-seq
MIRT2031415	hsa-miR-4650-5p	CLIP-seq
MIRT2031416	hsa-miR-520g	CLIP-seq
MIRT2031417	hsa-miR-520h	CLIP-seq
MIRT2031418	hsa-miR-610	CLIP-seq
MIRT2031419	hsa-miR-885-3p	CLIP-seq
MIRT2262326	hsa-miR-1255a	CLIP-seq
MIRT2262327	hsa-miR-1255b	CLIP-seq
MIRT2031410	hsa-miR-125a-5p	CLIP-seq
MIRT2031411	hsa-miR-125b	CLIP-seq
MIRT2031412	hsa-miR-1291	CLIP-seq
MIRT1112422	hsa-miR-140-3p	CLIP-seq
MIRT2031413	hsa-miR-1972	CLIP-seq
MIRT2262328	hsa-miR-3134	CLIP-seq
MIRT2031414	hsa-miR-4319	CLIP-seq
MIRT2262329	hsa-miR-4426	CLIP-seq
MIRT2262330	hsa-miR-4647	CLIP-seq
MIRT2031415	hsa-miR-4650-5p	CLIP-seq
MIRT2262331	hsa-miR-4662b	CLIP-seq
MIRT2262332	hsa-miR-511	CLIP-seq
MIRT2031418	hsa-miR-610	CLIP-seq
MIRT2430787	hsa-miR-3119	CLIP-seq
MIRT2561898	hsa-miR-1234	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT2561899	hsa-miR-2355-3p	CLIP-seq
MIRT2561900	hsa-miR-3132	CLIP-seq
MIRT2561901	hsa-miR-3163	CLIP-seq
MIRT2561902	hsa-miR-320a	CLIP-seq
MIRT2561903	hsa-miR-320b	CLIP-seq
MIRT2561904	hsa-miR-320c	CLIP-seq
MIRT2561905	hsa-miR-320d	CLIP-seq
MIRT2561906	hsa-miR-3616-5p	CLIP-seq
MIRT2561907	hsa-miR-3647-5p	CLIP-seq
MIRT2561908	hsa-miR-3674	CLIP-seq
MIRT2561909	hsa-miR-374a	CLIP-seq
MIRT2561910	hsa-miR-374b	CLIP-seq
MIRT2561911	hsa-miR-3935	CLIP-seq
MIRT2561912	hsa-miR-4289	CLIP-seq
MIRT2561913	hsa-miR-4318	CLIP-seq
MIRT2561914	hsa-miR-4429	CLIP-seq
MIRT2561915	hsa-miR-4467	CLIP-seq
MIRT2561916	hsa-miR-4646-3p	CLIP-seq
MIRT2561917	hsa-miR-4693-5p	CLIP-seq
MIRT2561918	hsa-miR-4795-5p	CLIP-seq
MIRT2561919	hsa-miR-502-5p	CLIP-seq
MIRT2561920	hsa-miR-573	CLIP-seq
MIRT2561921	hsa-miR-592	CLIP-seq
MIRT2561922	hsa-miR-597	CLIP-seq
MIRT2561923	hsa-miR-892a	CLIP-seq
MIRT2561924	hsa-miR-944	CLIP-seq
MIRT2561898	hsa-miR-1234	CLIP-seq
MIRT2561900	hsa-miR-3132	CLIP-seq
MIRT2561901	hsa-miR-3163	CLIP-seq
MIRT2561902	hsa-miR-320a	CLIP-seq
MIRT2561903	hsa-miR-320b	CLIP-seq
MIRT2561904	hsa-miR-320c	CLIP-seq
MIRT2561905	hsa-miR-320d	CLIP-seq
MIRT2683953	hsa-miR-337-3p	CLIP-seq
MIRT2561906	hsa-miR-3616-5p	CLIP-seq
MIRT2561907	hsa-miR-3647-5p	CLIP-seq
MIRT2561908	hsa-miR-3674	CLIP-seq
MIRT2683954	hsa-miR-3685	CLIP-seq
MIRT2561909	hsa-miR-374a	CLIP-seq
MIRT2561910	hsa-miR-374b	CLIP-seq
MIRT2683955	hsa-miR-384	CLIP-seq
MIRT2561911	hsa-miR-3935	CLIP-seq
MIRT2561912	hsa-miR-4289	CLIP-seq
MIRT2683956	hsa-miR-4328	CLIP-seq
MIRT2561914	hsa-miR-4429	CLIP-seq
MIRT2561915	hsa-miR-4467	CLIP-seq
MIRT2683957	hsa-miR-4729	CLIP-seq
MIRT2561918	hsa-miR-4795-5p	CLIP-seq
MIRT2561919	hsa-miR-502-5p	CLIP-seq
MIRT2561920	hsa-miR-573	CLIP-seq
MIRT2561924	hsa-miR-944	CLIP-seq

Transcription factor	Regulation	Reference
TFAP2A	Activation	15894523

38 Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002480	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS
GO:0004177	Function	Aminopeptidase activity	EXP	9668046, 11062501, 19498108, 19918052
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	TAS	15691326
GO:0005515	Function	Protein binding	IPI	12080061, 22153077, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11108258
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	8550619
GO:0007267	Process	Cell-cell signaling	TAS	8550619
GO:0007565	Process	Female pregnancy	TAS	8550619
GO:0008217	Process	Regulation of blood pressure	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9177475
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8550619
GO:0010813	Process	Neuropeptide catabolic process	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031905	Component	Early endosome lumen	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	25534853

MIM	HGNC	e!Ensembl
151300	6656	ENSG00000113441

Q9UIQ6

Protein name

Leucyl-cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Oxytocinase) (OTase) (Placental leucine aminopeptidase) (P-LAP) [Cleaved into: Leucyl-cystinyl a

Protein function

Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be

PDB

4P8Q , 4PJ6 , 4Z7I , 5C97 , 5JHQ , 5MJ6 , 7ZYF , 8CGP , 8CGW , 8P0I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01433	Peptidase_M1	392 → 610	Peptidase family M1 domain	Domain
PF11838	ERAP1_C	689 → 1009	ERAP1-like C-terminal domain	Domain
PF17900	Peptidase_M1_N	173 → 358		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta, heart, kidney and small intestine. Detected at lower levels in neuronal cells in the brain, in skeletal muscle, spleen, liver, testes and colon. {ECO:0000269|PubMed:11389728, ECO:0000269|PubMed:8550619, EC

Sequence

MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL

Sequence length

1025

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Renin-angiotensin system	Endosomal/Vacuolar pathway
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
BIRDSHOT CHORIORETINOPATHY	—	GWAS catalog	24957906	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35915156	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	11730987	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	23603761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (110)
Acute fatty liver of pregnancy	Fatty Liver	BEFREE	20953066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	29456727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10571045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	11730987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	28477791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27834335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	21348480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26923013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	2624428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	25540605, 30940621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23897274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22913580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30370863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28283809		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	1643026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	26418075		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	1643026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	GWASDB_DG	24957906		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	GWASCAT_DG	24957906		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	24957906, 34727153	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	19289584, 19369627, 19864236, 24698965, 25367072, 25818873, 26473483, 26754674, 27180259, 27455837, 27834335, 28764718, 30953146, 31076089, 31732618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27834335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15907336, 25133707, 3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23897274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23897274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38001104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31806131		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26242403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26242403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12569180, 14749039, 8703954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	12569180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30144577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1596896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	12361682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16368518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10571045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1386092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	37813091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15187412, 23897274, 31612634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes insipidus	Pubtator	20953066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	29463074, 31345525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15187412, 23897274, 31612634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23897274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15187412, 28225806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	16187279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15491750, 16187279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17233921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31638258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25133707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29108123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27639088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28555065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28555065		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	20953066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	20953066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21858921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	14749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	29631952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile pauciarticular chronic arthritis	Pauciarticular chronic arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	17692401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16368518, 23742296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	20953066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30348538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19289584, 19369627, 19864236, 24504069, 25367072, 25818873, 26223814, 26473483, 26754674, 26820945, 27180259, 27455837, 27716627, 27834335, 28764718, 30520947, 31076089, 31732618 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15907336, 3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28917266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29901187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24464224, 24551292, 31837433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26242403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1596896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30241820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	22523362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30348538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	11730987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	38001104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	19279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	30564623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10440809, 15907336, 1596896, 21692598, 26242403, 26956263, 27180259, 28032917, 28192599, 30520947, 31375912, 3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	29463074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30370863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29108123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24389591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	GWASCAT_DG	23603761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	30286779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23402025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	19136952, 20518521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31774020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative	Seronegative polyarthritis	GWASCAT_DG	23603761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28917266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31303963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23897274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	23897274, 34589554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17692401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1386092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28035472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	3325192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29108123, 29463916, 31295293, 31377187, 31807383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29901187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	26306513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	30527189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	30527189		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CLIC4	3	["Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Polyarticular juvenile idiopathic arthritis"]	[]	3	["GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)"]
ZFP36L1	3	["Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Polyarticular juvenile idiopathic arthritis"]	[]	3	["GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)"]
PRR5L	3	["Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Polyarticular juvenile idiopathic arthritis"]	[]	3	["GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)"]
TOMM7	3	["Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Polyarticular juvenile idiopathic arthritis"]	[]	3	["GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)"]
ANKRD55	4	["Iga nephropathy","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Polyarticular juvenile idiopathic arthritis"]	[]	4	["GWAS catalog (Iga nephropathy)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)"]

LNPEP (leucyl and cystinyl aminopeptidase)

Bookmark This Gene