LILRA3 (leukocyte immunoglobulin like receptor A3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 11026
Gene name Leukocyte immunoglobulin like receptor A3
Gene symbol LILRA3
Synonyms (NCBI Gene)
CD85EHM31HM43ILT-6ILT6LIR-4LIR4
Chromosome 19
Chromosome location 19q13.4
Summary This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018243 hsa-miR-335-5p Microarray 18185580
MIRT1109248 hsa-miR-1261 CLIP-seq
MIRT1109249 hsa-miR-490-5p CLIP-seq
MIRT1109250 hsa-miR-944 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604818 6604 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N6C8
Protein name Leukocyte immunoglobulin-like receptor subfamily A member 3 (CD85 antigen-like family member E) (Immunoglobulin-like transcript 6) (ILT-6) (Leukocyte immunoglobulin-like receptor 4) (LIR-4) (Monocyte inhibitory receptor HM43/HM31) (CD antigen CD85e)
Protein function Acts as a soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2. Binds with high affinity to the surface of monocytes, leading to abolish
PDB 3Q2C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 → 118 Immunoglobulin domain Domain
PF13895 Ig_2 325 → 419 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung. {ECO:0000269|PubMed:9278324, ECO:0000269|PubMed:9548455}.
Sequence 
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE
Sequence length 439
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Osteoclast differentiation Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
B cell receptor signaling pathway Neutrophil degranulation
Sort by:
LOC102725035 3 shared pathwaysOsteoclast differentiation, B cell receptor signaling pathway, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Osteoclast differentiation, B cell receptor signaling pathway. LOC107987462 3 shared pathwaysOsteoclast differentiation, B cell receptor signaling pathway, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Osteoclast differentiation, B cell receptor signaling pathway. LILRB1 3 shared pathwaysOsteoclast differentiation, B cell receptor signaling pathway, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Osteoclast differentiation, B cell receptor signaling pathway. LILRB5 3 shared pathwaysOsteoclast differentiation, B cell receptor signaling pathway, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Osteoclast differentiation, B cell receptor signaling pathway. LILRB4 3 shared pathwaysOsteoclast differentiation, B cell receptor signaling pathway, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Osteoclast differentiation, B cell receptor signaling pathway.
Schizophrenia Linked via 1 of 5 related genesLILRB1 Hepatocellular carcinoma Linked via 1 of 5 related genesLILRB5 Colorectal cancer Linked via 1 of 5 related genesLILRB4