LCORL (ligand dependent nuclear receptor corepressor like)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 254251
• Gene name: Ligand dependent nuclear receptor corepressor like
• Gene symbol: LCORL
• Synonyms (NCBI Gene): MLR1
• Chromosome: 4
• Chromosome location: 4p15.31
• Summary: This gene encodes a transcription factor that appears to function in spermatogenesis. Polymorphisms in this gene are associated with measures of skeletal frame size and adult height. Alternative splicing results in multiple transcript variants. [provided

miRNA Show/Hide all (211)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020852	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT030939	hsa-miR-21-5p	Microarray	18591254
MIRT483930	hsa-miR-1273e	PAR-CLIP	22012620
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	22012620
MIRT483928	hsa-miR-4507	PAR-CLIP	22012620
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	22012620
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23592263
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT483928	hsa-miR-4507	PAR-CLIP	23592263
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23592263
MIRT020852	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020852	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT483930	hsa-miR-1273e	PAR-CLIP	22012620
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	22012620
MIRT483928	hsa-miR-4507	PAR-CLIP	22012620
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	22012620
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23592263
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT483928	hsa-miR-4507	PAR-CLIP	23592263
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23592263
MIRT1106029	hsa-miR-105	CLIP-seq
MIRT1106030	hsa-miR-1183	CLIP-seq
MIRT1106031	hsa-miR-122	CLIP-seq
MIRT1106032	hsa-miR-1305	CLIP-seq
MIRT1106033	hsa-miR-18a	CLIP-seq
MIRT1106034	hsa-miR-18b	CLIP-seq
MIRT1106035	hsa-miR-200b	CLIP-seq
MIRT1106036	hsa-miR-200c	CLIP-seq
MIRT1106037	hsa-miR-204	CLIP-seq
MIRT1106038	hsa-miR-2052	CLIP-seq
MIRT1106039	hsa-miR-21	CLIP-seq
MIRT1106040	hsa-miR-211	CLIP-seq
MIRT1106041	hsa-miR-3150a-3p	CLIP-seq
MIRT1106042	hsa-miR-3154	CLIP-seq
MIRT1106043	hsa-miR-3163	CLIP-seq
MIRT1106044	hsa-miR-3175	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106046	hsa-miR-323b-5p	CLIP-seq
MIRT1106047	hsa-miR-329	CLIP-seq
MIRT1106048	hsa-miR-34b	CLIP-seq
MIRT1106049	hsa-miR-3607-3p	CLIP-seq
MIRT1106050	hsa-miR-362-3p	CLIP-seq
MIRT1106051	hsa-miR-3646	CLIP-seq
MIRT1106052	hsa-miR-3671	CLIP-seq
MIRT1106053	hsa-miR-3686	CLIP-seq
MIRT1106054	hsa-miR-369-3p	CLIP-seq
MIRT1106055	hsa-miR-3714	CLIP-seq
MIRT1106056	hsa-miR-374a	CLIP-seq
MIRT1106057	hsa-miR-374b	CLIP-seq
MIRT1106058	hsa-miR-3922-5p	CLIP-seq
MIRT1106059	hsa-miR-3941	CLIP-seq
MIRT1106060	hsa-miR-4255	CLIP-seq
MIRT1106061	hsa-miR-4282	CLIP-seq
MIRT1106062	hsa-miR-429	CLIP-seq
MIRT1106063	hsa-miR-4307	CLIP-seq
MIRT1106064	hsa-miR-4325	CLIP-seq
MIRT1106065	hsa-miR-4434	CLIP-seq
MIRT1106066	hsa-miR-4440	CLIP-seq
MIRT1106067	hsa-miR-4446-5p	CLIP-seq
MIRT1106068	hsa-miR-4516	CLIP-seq
MIRT1106069	hsa-miR-4667-5p	CLIP-seq
MIRT1106070	hsa-miR-4691-3p	CLIP-seq
MIRT1106071	hsa-miR-4698	CLIP-seq
MIRT1106072	hsa-miR-4700-5p	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT1106074	hsa-miR-4735-3p	CLIP-seq
MIRT1106075	hsa-miR-4755-5p	CLIP-seq
MIRT1106076	hsa-miR-4761-5p	CLIP-seq
MIRT1106077	hsa-miR-4764-3p	CLIP-seq
MIRT1106078	hsa-miR-500a	CLIP-seq
MIRT1106079	hsa-miR-514	CLIP-seq
MIRT1106080	hsa-miR-514b-3p	CLIP-seq
MIRT1106081	hsa-miR-548a-3p	CLIP-seq
MIRT1106082	hsa-miR-548e	CLIP-seq
MIRT1106083	hsa-miR-548f	CLIP-seq
MIRT1106084	hsa-miR-556-3p	CLIP-seq
MIRT1106085	hsa-miR-574-5p	CLIP-seq
MIRT1106086	hsa-miR-590-5p	CLIP-seq
MIRT1106087	hsa-miR-592	CLIP-seq
MIRT1106088	hsa-miR-597	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT1106090	hsa-miR-606	CLIP-seq
MIRT1106091	hsa-miR-607	CLIP-seq
MIRT1106092	hsa-miR-623	CLIP-seq
MIRT1106093	hsa-miR-624	CLIP-seq
MIRT1106094	hsa-miR-633	CLIP-seq
MIRT1106095	hsa-miR-656	CLIP-seq
MIRT1106096	hsa-miR-939	CLIP-seq
MIRT2029282	hsa-miR-1260	CLIP-seq
MIRT2029283	hsa-miR-1260b	CLIP-seq
MIRT2029284	hsa-miR-133a	CLIP-seq
MIRT2029285	hsa-miR-133b	CLIP-seq
MIRT2029286	hsa-miR-1343	CLIP-seq
MIRT2029287	hsa-miR-188-3p	CLIP-seq
MIRT2029288	hsa-miR-3156-3p	CLIP-seq
MIRT2029289	hsa-miR-3165	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106049	hsa-miR-3607-3p	CLIP-seq
MIRT2029290	hsa-miR-3662	CLIP-seq
MIRT2029291	hsa-miR-4275	CLIP-seq
MIRT1106067	hsa-miR-4446-5p	CLIP-seq
MIRT2029292	hsa-miR-4456	CLIP-seq
MIRT2029293	hsa-miR-4636	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2029294	hsa-miR-4760-3p	CLIP-seq
MIRT2029295	hsa-miR-491-3p	CLIP-seq
MIRT1106081	hsa-miR-548a-3p	CLIP-seq
MIRT2029296	hsa-miR-548c-3p	CLIP-seq
MIRT1106082	hsa-miR-548e	CLIP-seq
MIRT1106083	hsa-miR-548f	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2260216	hsa-miR-101	CLIP-seq
MIRT2260217	hsa-miR-1208	CLIP-seq
MIRT2260218	hsa-miR-1228	CLIP-seq
MIRT2260219	hsa-miR-1237	CLIP-seq
MIRT2260220	hsa-miR-1248	CLIP-seq
MIRT2260221	hsa-miR-1264	CLIP-seq
MIRT1106032	hsa-miR-1305	CLIP-seq
MIRT2260222	hsa-miR-144	CLIP-seq
MIRT2260223	hsa-miR-15a	CLIP-seq
MIRT2260224	hsa-miR-15b	CLIP-seq
MIRT2260225	hsa-miR-16	CLIP-seq
MIRT2260226	hsa-miR-195	CLIP-seq
MIRT2260227	hsa-miR-203	CLIP-seq
MIRT2260228	hsa-miR-205	CLIP-seq
MIRT1106038	hsa-miR-2052	CLIP-seq
MIRT2260229	hsa-miR-296-3p	CLIP-seq
MIRT2260230	hsa-miR-299-5p	CLIP-seq
MIRT2260231	hsa-miR-300	CLIP-seq
MIRT1106041	hsa-miR-3150a-3p	CLIP-seq
MIRT1106042	hsa-miR-3154	CLIP-seq
MIRT2260232	hsa-miR-3160-5p	CLIP-seq
MIRT1106043	hsa-miR-3163	CLIP-seq
MIRT1106044	hsa-miR-3175	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106047	hsa-miR-329	CLIP-seq
MIRT1106048	hsa-miR-34b	CLIP-seq
MIRT1106050	hsa-miR-362-3p	CLIP-seq
MIRT2260233	hsa-miR-3647-3p	CLIP-seq
MIRT2029290	hsa-miR-3662	CLIP-seq
MIRT1106052	hsa-miR-3671	CLIP-seq
MIRT1106055	hsa-miR-3714	CLIP-seq
MIRT2260234	hsa-miR-381	CLIP-seq
MIRT1106058	hsa-miR-3922-5p	CLIP-seq
MIRT1106059	hsa-miR-3941	CLIP-seq
MIRT2260235	hsa-miR-424	CLIP-seq
MIRT1106061	hsa-miR-4282	CLIP-seq
MIRT1106063	hsa-miR-4307	CLIP-seq
MIRT2260236	hsa-miR-4328	CLIP-seq
MIRT1106065	hsa-miR-4434	CLIP-seq
MIRT1106068	hsa-miR-4516	CLIP-seq
MIRT2260237	hsa-miR-452	CLIP-seq
MIRT2260238	hsa-miR-4528	CLIP-seq
MIRT2260239	hsa-miR-4652-3p	CLIP-seq
MIRT2260240	hsa-miR-4666-3p	CLIP-seq
MIRT1106069	hsa-miR-4667-5p	CLIP-seq
MIRT2260241	hsa-miR-4676-3p	CLIP-seq
MIRT1106070	hsa-miR-4691-3p	CLIP-seq
MIRT1106071	hsa-miR-4698	CLIP-seq
MIRT1106072	hsa-miR-4700-5p	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2260242	hsa-miR-4731-3p	CLIP-seq
MIRT2260243	hsa-miR-4753-3p	CLIP-seq
MIRT2029294	hsa-miR-4760-3p	CLIP-seq
MIRT2260244	hsa-miR-4768-5p	CLIP-seq
MIRT2260245	hsa-miR-4797-5p	CLIP-seq
MIRT2260246	hsa-miR-4801	CLIP-seq
MIRT2260247	hsa-miR-497	CLIP-seq
MIRT2260248	hsa-miR-5096	CLIP-seq
MIRT2260249	hsa-miR-522	CLIP-seq
MIRT2260250	hsa-miR-543	CLIP-seq
MIRT2260251	hsa-miR-548n	CLIP-seq
MIRT2260252	hsa-miR-548t	CLIP-seq
MIRT2260253	hsa-miR-561	CLIP-seq
MIRT2260254	hsa-miR-582-5p	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2260255	hsa-miR-616	CLIP-seq
MIRT1106094	hsa-miR-633	CLIP-seq
MIRT2260256	hsa-miR-889	CLIP-seq
MIRT1106096	hsa-miR-939	CLIP-seq
MIRT2260216	hsa-miR-101	CLIP-seq
MIRT2260222	hsa-miR-144	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2260242	hsa-miR-4731-3p	CLIP-seq
MIRT2260246	hsa-miR-4801	CLIP-seq
MIRT2260254	hsa-miR-582-5p	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2438332	hsa-miR-323-3p	CLIP-seq
MIRT2438333	hsa-miR-411	CLIP-seq
MIRT2452897	hsa-miR-1323	CLIP-seq
MIRT1106051	hsa-miR-3646	CLIP-seq
MIRT2452898	hsa-miR-548o	CLIP-seq
MIRT2452899	hsa-miR-944	CLIP-seq
MIRT2438332	hsa-miR-323-3p	CLIP-seq
MIRT2438333	hsa-miR-411	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21900206, 24981860, 25416956, 28514442, 31041561, 32296183, 33961781, 35016035
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:1990226	Function	Histone methyltransferase binding	IEA
GO:1990226	Function	Histone methyltransferase binding	IPI	29628311

Other IDs

• MIM: 611799
• HGNC: 30776
• e!Ensembl: ENSG00000178177

Protein

• UniProt ID: Q8N3X6
• Protein name: Ligand-dependent nuclear receptor corepressor-like protein (LCoR-like protein)
• Protein function: May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'. May play a role in spermatogenesis (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05225	HTH_psq	526 → 571	helix-turn-helix, Psq domain	Domain
  PF05225	HTH_psq	277 → 314	helix-turn-helix, Psq domain	Domain

• Sequence:

  MDKGRERMAAAAAAAAAAAAAAQCRSPRCAAERRGFRRELDSWRHRLMHCVGFESILEGL
  YGPRLRRDLSLFEDCEPEELTDWSMDEKCSFCNLQREAVSDCIPSLDSSQSTPTEELSSQ
  GQSNTDKIECQAENYLNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQ
  ENRNGSIGPSIVCKSIQMNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTKKTS
  IKSEESSICDPSSENSVAGRLHRNREDYVERSAEFADGLLSKALKDIQSGALDINKAGIL
  YGIPQKTLLLHLEALPAGKPASFKNKTRDFHDSYSYKDSKETCAVLQKVALWARAQAERT
  EKSKLNLLETSEIKFPTASTYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVS
  SVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSVDSYFL
  HGDLSPLCLNSKNGTVDGTSENTEDGLDRKDSKQPRKKRGRYRQYDHEIMEEAIAMVMSG
  KMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKLRLPDTGLYNMTDSGTGSCKNSSK
  PV

• Sequence length: 602

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (26)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35851147	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	36009466	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	24743840	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33632238, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	35851147	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPITUITARISM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	33230300	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	34162658	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	31701892, 38155330	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 31374203, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	29924316	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 35551307, 38374256, 38685053, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	29860282	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29924316	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37328865	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	27986804		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	28744006	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37328865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	29924316		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	29924316		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

VSTM4 2 shared diseasesCataract, Diverticular disease 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Diverticular disease) Related via 2 shared diseases including Cataract, Diverticular disease — evidence mostly GWAS catalog. ARHGAP1 2 shared diseasesDiverticular disease, Hypertrophic cardiomyopathy 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Hypertrophic cardiomyopathy) Related via 2 shared diseases including Diverticular disease, Hypertrophic cardiomyopathy — evidence mostly GWAS catalog. SRL 2 shared diseasesDiverticular disease, Hypertrophic cardiomyopathy 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Hypertrophic cardiomyopathy) Related via 2 shared diseases including Diverticular disease, Hypertrophic cardiomyopathy — evidence mostly GWAS catalog. STXBP6 2 shared diseasesCataract, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Gastroesophageal reflux disease) Related via 2 shared diseases including Cataract, Gastroesophageal reflux disease — evidence mostly GWAS catalog. MAPKAP1 2 shared diseasesDiverticular disease, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Gastroesophageal reflux disease) Related via 2 shared diseases including Diverticular disease, Gastroesophageal reflux disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
VSTM4	2	["Cataract","Diverticular disease"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Diverticular disease)"]
ARHGAP1	2	["Diverticular disease","Hypertrophic cardiomyopathy"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Hypertrophic cardiomyopathy)"]
SRL	2	["Diverticular disease","Hypertrophic cardiomyopathy"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Hypertrophic cardiomyopathy)"]
STXBP6	2	["Cataract","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Gastroesophageal reflux disease)"]
MAPKAP1	2	["Diverticular disease","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Gastroesophageal reflux disease)"]

Diseases Linked via Similar Genes

Migraine Linked via 1 of 5 related genesVSTM4 Open angle glaucoma Linked via 1 of 5 related genesARHGAP1 Obesity Linked via 1 of 5 related genesSRL Ocular sarcoidosis Linked via 1 of 5 related genesSTXBP6 Asthma Linked via 1 of 5 related genesMAPKAP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Migraine	1	["VSTM4"]
Open angle glaucoma	1	["ARHGAP1"]
Obesity	1	["SRL"]
Ocular sarcoidosis	1	["STXBP6"]
Asthma	1	["MAPKAP1"]