KRT72 (keratin 72)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140807
Gene name Keratin 72
Gene symbol KRT72
Synonyms (NCBI Gene)
CK-72K6IRS2K6irsK72KRT6KRT6IRS2
Chromosome 12
Chromosome location 12q13.13
Summary Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells. The type II keratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiatio
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT016775 hsa-miR-335-5p Microarray 18185580
MIRT2258901 hsa-miR-3606 CLIP-seq
MIRT2258902 hsa-miR-4493 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0030280 Function Structural constituent of skin epidermis IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608246 28932 ENSG00000170486
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14CN4
Protein name Keratin, type II cytoskeletal 72 (Cytokeratin-72) (CK-72) (Keratin-72) (K72) (Type II inner root sheath-specific keratin-K6irs2) (Type-II keratin Kb35)
Protein function Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (Probable).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 124 → 437 Intermediate filament protein Coiled-coil
PF16208 Keratin_2_head 62 → 121 Keratin type II head Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in hair follicles from scalp and eyebrow. Also expressed in palmoplantar epidermis. Not expressed in face skin despite the presence of fine hairs histologically. In hair, it is specifically present in the inner root sh
Sequence 
MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLAL
SAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQR
VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI
SNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAY
MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVR
AQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNV
KKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLAL
DMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAA
DVKTKGSCGSELKDPLAKTSGSSCATKKASR
Sequence length 511
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization
Formation of the cornified envelope
Sort by:
PKP3 2 shared pathwaysKeratinization, Formation of the cornified envelope Related via 2 shared pathways including Keratinization, Formation of the cornified envelope. KRT71 2 shared pathwaysKeratinization, Formation of the cornified envelope Related via 2 shared pathways including Keratinization, Formation of the cornified envelope. KRT74 2 shared pathwaysKeratinization, Formation of the cornified envelope Related via 2 shared pathways including Keratinization, Formation of the cornified envelope. KRT80 2 shared pathwaysKeratinization, Formation of the cornified envelope Related via 2 shared pathways including Keratinization, Formation of the cornified envelope. DSG4 2 shared pathwaysKeratinization, Formation of the cornified envelope Related via 2 shared pathways including Keratinization, Formation of the cornified envelope.
Hypotrichosis Linked via 3 of 5 related genesKRT71, KRT74, DSG4 Androgenetic alopecia Linked via 2 of 5 related genesKRT71, KRT74 Woolly hair Linked via 2 of 5 related genesKRT71, KRT74 Hypotrichosis simplex Linked via 2 of 5 related genesKRT74, DSG4 Anorectal malformation Linked via 1 of 5 related genesPKP3