KRT36 (keratin 36)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8689
Gene name Keratin 36
Gene symbol KRT36
Synonyms (NCBI Gene)
HA6KRTHA6hHa6
Chromosome 17
Chromosome location 17q21.2
Summary The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604540 6454 ENSG00000126337
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O76013
Protein name Keratin, type I cuticular Ha6 (Hair keratin, type I Ha6) (Keratin-36) (K36)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 92 → 403 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the hair follicles. {ECO:0000269|PubMed:9756910}.
Sequence 
MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLG
SCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESRIQEWYEFQIPYICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQMQCLISNVEA
QLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVP
SVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
Sequence length 467
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Estrogen signaling pathway Keratinization
Staphylococcus aureus infection Formation of the cornified envelope
Sort by:
LOC100653049 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT40 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT25 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT28 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT24 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection.
Androgenetic alopecia Linked via 1 of 5 related genesKRT25 Hypotrichosis Linked via 1 of 5 related genesKRT25 Woolly hair Linked via 1 of 5 related genesKRT25 Asthma Linked via 1 of 5 related genesKRT24