KRT28 (keratin 28)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 162605
Gene name Keratin 28
Gene symbol KRT28
Synonyms (NCBI Gene)
K25IRS4KRT25D
Chromosome 17
Chromosome location 17q21.2
Summary This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with a
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT036264 hsa-miR-1229-3p CLASH 23622248
MIRT1101250 hsa-miR-1257 CLIP-seq
MIRT1101251 hsa-miR-3688-3p CLIP-seq
MIRT1101252 hsa-miR-4276 CLIP-seq
MIRT1101253 hsa-miR-4790-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616677 30842 ENSG00000173908
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3Y7
Protein name Keratin, type I cytoskeletal 28 (Cytokeratin-28) (CK-28) (Keratin-25D) (K25D) (Keratin-28) (K28) (Type I inner root sheath-specific keratin-K25irs4)
Protein function Essential for the proper assembly of types I and II keratin protein complexes and the formation of keratin intermediate filaments in the inner root sheath (irs).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 85 → 400 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in skin and scalp, and weak expression observed in thymus. In the hair follicle, expressed in Henle layer, Huxley layer and in the irs cuticle. Expression extends from the bulb region up to the point of differentiati
Sequence 
MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
FARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLS
KTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Sequence length 464
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Estrogen signaling pathway Keratinization
Staphylococcus aureus infection Formation of the cornified envelope
Sort by:
LOC100653049 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT40 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT25 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT24 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT23 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection.
Androgenetic alopecia Linked via 1 of 5 related genesKRT25 Hypotrichosis Linked via 1 of 5 related genesKRT25 Woolly hair Linked via 1 of 5 related genesKRT25 Asthma Linked via 1 of 5 related genesKRT24