KRT35 (keratin 35)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3886
Gene name Keratin 35
Gene symbol KRT35
Synonyms (NCBI Gene)
HA5Ha-5K35KRTHA5hHa5
Chromosome 17
Chromosome location 17q21.2
Summary The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1101288 hsa-miR-1296 CLIP-seq
MIRT1101289 hsa-miR-2909 CLIP-seq
MIRT1101290 hsa-miR-298 CLIP-seq
MIRT1101291 hsa-miR-3678-3p CLIP-seq
MIRT1101292 hsa-miR-4253 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space HDA 23580065
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602764 6453 ENSG00000197079
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92764
Protein name Keratin, type I cuticular Ha5 (Hair keratin, type I Ha5) (Keratin-35) (K35)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 96 → 407 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Early expression in the hair follicle, mainly found in supramatricial cells and lowermost cortical cells of the hair bulb. {ECO:0000269|PubMed:8823373}.
Sequence 
MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFSACSVGLGRSS
YRATSCLPALCLPAGGFATSYSGGGGWFGEGILTGNEKETMQSLNDRLAGYLEKVRQLEQ
ENASLESRIREWCEQQVPYMCPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAAD
DFRTKYETEVSLRQLVESDINGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVV
SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSSQLAQMQCMIT
NVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF
Sequence length 455
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Estrogen signaling pathway Keratinization
Staphylococcus aureus infection Formation of the cornified envelope
Sort by:
LOC100653049 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT40 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT25 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT28 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT24 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection.
Androgenetic alopecia Linked via 1 of 5 related genesKRT25 Hypotrichosis Linked via 1 of 5 related genesKRT25 Woolly hair Linked via 1 of 5 related genesKRT25 Asthma Linked via 1 of 5 related genesKRT24