KRT33A (keratin 33A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3883
Gene name Keratin 33A
Gene symbol KRT33A
Synonyms (NCBI Gene)
HA3IHa-3IK33AKRTHA3AKrt1-3hHa3-I
Chromosome 17
Chromosome location 17q21.2
Summary This gene encodes a member of the keratin gene family. This gene is one of multiple type I hair keratin genes that are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. As a type I hair keratin, the encoded protei
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT022468 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005615 Component Extracellular space HDA 23580065
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602761 6450 ENSG00000006059
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O76009
Protein name Keratin, type I cuticular Ha3-I (Hair keratin, type I Ha3-I) (Keratin-33A) (K33A)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 55 → 366 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the hair follicles. {ECO:0000269|PubMed:9756910}.
Sequence 
MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLASDDFRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNQVLNETRSQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCNTFGY
Sequence length 404
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Estrogen signaling pathway Keratinization
Staphylococcus aureus infection Formation of the cornified envelope
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Prostate cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
LOC100653049 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT40 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT25 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT28 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT24 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection.
Androgenetic alopecia Linked via 1 of 5 related genesKRT25 Hypotrichosis Linked via 1 of 5 related genesKRT25 Woolly hair Linked via 1 of 5 related genesKRT25 Asthma Linked via 1 of 5 related genesKRT24