KRT27 (keratin 27)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 342574
Gene name Keratin 27
Gene symbol KRT27
Synonyms (NCBI Gene)
K25IRS3KRT25C
Chromosome 17
Chromosome location 17q21.2
Summary This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with a
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 32296183, 33961781, 36217029
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616676 30841 ENSG00000171446
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3Y8
Protein name Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3)
Protein function Essential for the proper assembly of type I and type II keratin protein complexes and formation of keratin intermediate filaments in the inner root sheath (irs).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 83 → 398 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in skin and scalp. In the hair follicle, expressed in Henle layer, Huxley layer and in the inner root sheath cuticle of the hair follicle. Expression extends from the bulb region up to the point of differentiation in
Sequence 
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS
Sequence length 459
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Estrogen signaling pathway Keratinization
Staphylococcus aureus infection Formation of the cornified envelope
Sort by:
LOC100653049 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT40 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT25 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT28 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection. KRT24 4 shared pathwaysEstrogen signaling pathway, Staphylococcus aureus infection, Keratinization, Formation of the cornified envelope Related via 4 shared pathways including Estrogen signaling pathway, Staphylococcus aureus infection.
Androgenetic alopecia Linked via 1 of 5 related genesKRT25 Hypotrichosis Linked via 1 of 5 related genesKRT25 Woolly hair Linked via 1 of 5 related genesKRT25 Asthma Linked via 1 of 5 related genesKRT24