Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	354
Gene name	Kallikrein related peptidase 3
Gene symbol	KLK3
Synonyms (NCBI Gene)	APSKLK2A1PSAhK3
Chromosome	19
Chromosome location	19q13.33
Summary	Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one o

10 Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017222	hsa-miR-335-5p	Microarray	18185580
MIRT1099048	hsa-miR-3150a-3p	CLIP-seq
MIRT1099049	hsa-miR-3175	CLIP-seq
MIRT1099050	hsa-miR-4514	CLIP-seq
MIRT1099051	hsa-miR-4645-5p	CLIP-seq
MIRT1099052	hsa-miR-4673	CLIP-seq
MIRT1099053	hsa-miR-4692	CLIP-seq
MIRT1099054	hsa-miR-939	CLIP-seq
MIRT2390004	hsa-miR-4268	CLIP-seq
MIRT2390005	hsa-miR-4717-5p	CLIP-seq

29 Show/Hide all (29)

Transcription factor	Regulation	Reference
AATF	Unknown	23146908
AR	Activation	10547578;11006269;11504717;11571582;12958311;16425097;16434977;16724108;17566103;20069563;21780100;22179832;23667504;8626436
AR	Repression	16342680;9316650
AR	Unknown	11059779;11238180;11532861;12376473;12539223;12648523;12651911;15368351;15543614;15557561;15640095;17011549;17075604;17094454;17426252;17433535;18780293;18829551;19274665;21308712;21981678;22245379;22473899;23884959;24307657;7514587;9052414;9211894
AR	Unknown	24937452
BTG2	Repression	21172304
EGR1	Repression	15517885
EP300	Unknown	23884959
FOXP1	Repression	18640093
FUS	Unknown	21909421
HIF1A	Unknown	23884959
NCOA4	Activation	18649734
NFKB1	Activation	11909978
NFKB1	Repression	15517885
NKX3-1	Unknown	17483333
PA2G4	Repression	16254079
PGR	Unknown	9052414
REL	Unknown	17011549
RELA	Repression	15517885
RREB1	Repression	17550981
RUNX1	Unknown	16237704
RUNX2	Unknown	16237704
SIN3A	Repression	16254079
SP1	Activation	15708372
SP3	Activation	15708372
SPDEF	Unknown	16237704;17483333
SRCAP	Activation	20432434
TRPS1	Unknown	14680804
WT1	Unknown	18631392

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002803	Process	Positive regulation of antibacterial peptide production	IDA	18714013
GO:0003073	Process	Regulation of systemic arterial blood pressure	IBA
GO:0004175	Function	Endopeptidase activity	IDA	18714013
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IMP	15563730
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	1725227, 8665956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8665956
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IMP	15563730
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2470553
GO:0016525	Process	Negative regulation of angiogenesis	NAS	10675891
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IMP	8665956
GO:0030141	Component	Secretory granule	IBA
GO:0031638	Process	Zymogen activation	IBA
GO:0032991	Component	Protein-containing complex	IDA	8665956
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
176820	6364	ENSG00000142515

P07288

Protein name

Prostate-specific antigen (PSA) (EC 3.4.21.77) (Gamma-seminoprotein) (Seminin) (Kallikrein-3) (P-30 antigen) (Semenogelase)

Protein function

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

PDB

2ZCH , 2ZCK , 2ZCL , 3QUM , 9F1I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	25 → 253	Trypsin	Domain

Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP

Sequence length

261

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Pathways in cancer	Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Prostate cancer	Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (22)
BREAST CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889, 35729236	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	31533690	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KLK3-related disorder	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	18264097, 24740154, 24753544, 26034056, 29892016, 31562322, 32514122, 33293427, 33398198, 34012061, 34290314, 34594039, 37340002, 37945903, 38538606, 38632662, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	18264097, 24740154, 24753544, 25939597, 26034056, 29892016, 31562322, 32514122, 32887889, 33293427, 33398198, 34012061, 34290314, 34594039, 37340002, 37945903, 38538606, 38632662, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC HYPERPLASIA	—	CTD	21128595	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC HYPERTROPHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	12644816, 15790600, 16424004, 16442593, 16984552, 17003774, 17148459, 18264097, 18500220, 18676866, 27318894	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
KLK2	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3"]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
LMTK2	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
PRKCI	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
MSMB	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
MIER3	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]

KLK3 (kallikrein related peptidase 3)

Save This Analysis