KIR3DL3 (killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 115653
Gene name Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
Gene symbol KIR3DL3
Synonyms (NCBI Gene)
CD158ZKIR2DL5BKIR3DL7KIR44KIRC1
Chromosome 19
Chromosome location 19q13.42
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007154 Process Cell communication IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610095 16312 ENSG00000242019
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N743
Protein name Killer cell immunoglobulin-like receptor 3DL3 (CD158 antigen-like family member Z) (Killer cell inhibitory receptor 1) (CD antigen CD158z)
Protein function Receptor on natural killer cells. May inhibit the activity of NK cells thus preventing cell lysis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 110 Immunoglobulin domain Domain
PF00047 ig 227 → 307 Immunoglobulin domain Domain
Sequence 
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRAL
PHAWSDPSDPLPVSVTGNSRHLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEP
AGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV
Sequence length 410
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Antigen processing and presentation
Graft-versus-host disease
Sort by:
LOC112268355 2 shared pathwaysAntigen processing and presentation, Graft-versus-host disease Related via 2 shared pathways including Antigen processing and presentation, Graft-versus-host disease. KIR3DS1 2 shared pathwaysAntigen processing and presentation, Graft-versus-host disease Related via 2 shared pathways including Antigen processing and presentation, Graft-versus-host disease. KIR2DL5A 2 shared pathwaysAntigen processing and presentation, Graft-versus-host disease Related via 2 shared pathways including Antigen processing and presentation, Graft-versus-host disease. KIR2DL1 2 shared pathwaysAntigen processing and presentation, Graft-versus-host disease Related via 2 shared pathways including Antigen processing and presentation, Graft-versus-host disease. KIR2DL2 2 shared pathwaysAntigen processing and presentation, Graft-versus-host disease Related via 2 shared pathways including Antigen processing and presentation, Graft-versus-host disease.
Fatigue syndrome Linked via 1 of 5 related genesKIR3DS1 Liver cirrhosis Linked via 1 of 5 related genesKIR3DS1 Lymphoproliferative syndrome Linked via 1 of 5 related genesKIR3DS1 Keratoconus Linked via 1 of 5 related genesKIR2DL1 Autoimmune hepatitis Linked via 1 of 5 related genesKIR2DL2