KIF2B (kinesin family member 2B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84643
• Gene name: Kinesin family member 2B
• Gene symbol: KIF2B
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q22

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2025315	hsa-miR-1266	CLIP-seq
MIRT2025316	hsa-miR-3664-3p	CLIP-seq
MIRT2025317	hsa-miR-4433	CLIP-seq
MIRT2025318	hsa-miR-4459	CLIP-seq
MIRT2025319	hsa-miR-4503	CLIP-seq
MIRT2025320	hsa-miR-4518	CLIP-seq
MIRT2025321	hsa-miR-4768-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007019	Process	Microtubule depolymerization	IEA
GO:0007019	Process	Microtubule depolymerization	IMP	19060894
GO:0007019	Process	Microtubule depolymerization	TAS	26323690
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IMP	23891108
GO:0051983	Process	Regulation of chromosome segregation	IMP	19060894

Other IDs

• MIM: 615142
• HGNC: 29443
• e!Ensembl: ENSG00000141200

Protein

• UniProt ID: Q8N4N8
• Protein name: Kinesin-like protein KIF2B
• Protein function: Plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. Has microtubule depolymerization activity (PubMed:17538014). Plays a role in chromosome congression (PubMed:23891108). {ECO:0000269|PubMed:17538
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	219 → 543	Kinesin motor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest level in lung. High level in ovary, moderate levels in heart, kidney, placenta, skeletal muscle and spleen (at protein level). Pancreas and spleen express a shorter isoform (at protein level). {ECO:0000269|PubMed:17538014}.
• Sequence:

  MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEW
  VEKAVKKGKKIDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIP
  QKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNT
  RNPNYEIMHMIEEYRRHLDSSKISVLEPPQEHRICVCVRKRPLNQRETTLKDLDIITVPS
  DNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVYQFTAQPLVESIFRKGMATCF
  AYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIY
  GGKVYDLLNWKKKLQVLEDGNQQIQVVGLQEKEVCCVEEVLNLVEIGNSCRTSRQTPVNA
  HSSRSHAVFQIILKSGRIMHGKFSLVDLAGNERGADTTKASRKRQLEGAEINKSLLALKE
  CILALGQNKPHTPFRASKLTLVLRDSFIGQNSSTCMIATISPGMTSCENTLNTLRYANRV
  KKLNVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVET
  LPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLK
  LLLADLHVKSKVE

• Sequence length: 673

Pathways

KEGG Pathway	Reactome Pathway
Motor proteins	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
	MHC class II antigen presentation
	Separation of Sister Chromatids
	Resolution of Sister Chromatid Cohesion
	RHO GTPases Activate Formins
	COPI-dependent Golgi-to-ER retrograde traffic
	Mitotic Prometaphase
	EML4 and NUDC in mitotic spindle formation
	Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (10)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX REGIONAL PAIN SYNDROME	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY MALIGNANT NEOPLASM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26443250		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26443250		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26443250		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19046961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25111073		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25111073		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25111073	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CENPE 10 shared pathwaysMotor proteins, COPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, MHC class II antigen presentation, Kinesins Related via 10 shared pathways including Motor proteins, COPI-dependent Golgi-to-ER retrograde traffic. KIF2C 10 shared pathwaysMotor proteins, COPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, MHC class II antigen presentation, Kinesins Related via 10 shared pathways including Motor proteins, COPI-dependent Golgi-to-ER retrograde traffic. KIF2A 10 shared pathwaysMotor proteins, COPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, MHC class II antigen presentation, Kinesins Related via 10 shared pathways including Motor proteins, COPI-dependent Golgi-to-ER retrograde traffic. KIF18A 10 shared pathwaysMotor proteins, COPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, MHC class II antigen presentation, Kinesins Related via 10 shared pathways including Motor proteins, COPI-dependent Golgi-to-ER retrograde traffic. ZW10 7 shared pathwaysCOPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including COPI-dependent Golgi-to-ER retrograde traffic, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CENPE	0	[]	10	["Motor proteins","COPI-dependent Golgi-to-ER retrograde traffic","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","MHC class II antigen presentation","Kinesins"]	0	[]
KIF2C	0	[]	10	["Motor proteins","COPI-dependent Golgi-to-ER retrograde traffic","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","MHC class II antigen presentation","Kinesins"]	0	[]
KIF2A	0	[]	10	["Motor proteins","COPI-dependent Golgi-to-ER retrograde traffic","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","MHC class II antigen presentation","Kinesins"]	0	[]
KIF18A	0	[]	10	["Motor proteins","COPI-dependent Golgi-to-ER retrograde traffic","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","MHC class II antigen presentation","Kinesins"]	0	[]
ZW10	0	[]	7	["COPI-dependent Golgi-to-ER retrograde traffic","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]

Diseases Linked via Similar Genes

Hepatocellular carcinoma Linked via 3 of 5 related genesCENPE, KIF2C, KIF18A Microcephaly Linked via 2 of 5 related genesCENPE, KIF2A Alzheimer disease Linked via 1 of 5 related genesCENPE Autism Linked via 1 of 5 related genesCENPE Primary microcephaly Linked via 1 of 5 related genesCENPE

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hepatocellular carcinoma	3	["CENPE","KIF2C","KIF18A"]
Microcephaly	2	["CENPE","KIF2A"]
Alzheimer disease	1	["CENPE"]
Autism	1	["CENPE"]
Primary microcephaly	1	["CENPE"]