Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10022
Gene name	Insulin like 5
Gene symbol	INSL5
Synonyms (NCBI Gene)	PRO182UNQ156
Chromosome	1
Chromosome location	1p31.3
Summary	The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008]

13 Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018088	hsa-miR-335-5p	Microarray	18185580
MIRT1067744	hsa-miR-141	CLIP-seq
MIRT1067745	hsa-miR-200a	CLIP-seq
MIRT1067746	hsa-miR-2682	CLIP-seq
MIRT1067747	hsa-miR-449c	CLIP-seq
MIRT1067748	hsa-miR-4514	CLIP-seq
MIRT1067749	hsa-miR-4645-5p	CLIP-seq
MIRT1067750	hsa-miR-4673	CLIP-seq
MIRT1067751	hsa-miR-4692	CLIP-seq
MIRT2552285	hsa-miR-182	CLIP-seq
MIRT2552286	hsa-miR-4470	CLIP-seq
MIRT2552285	hsa-miR-182	CLIP-seq
MIRT2552286	hsa-miR-4470	CLIP-seq

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	IEA
GO:2000253	Process	Positive regulation of feeding behavior	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IEA

MIM	HGNC	e!Ensembl
606413	6088	ENSG00000172410

Q9Y5Q6

Protein name

Insulin-like peptide INSL5 (Insulin-like peptide 5) [Cleaved into: Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain]

Protein function

May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.

PDB

2K1V , 2KBC , 7YJ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00049	Insulin	26 → 135	Insulin/IGF/Relaxin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in rectum with lower levels in uterus and ascending and descending colon. {ECO:0000269|PubMed:10458910}.

Sequence

MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAE
TGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTL
CCTDGCSMTDLSALC

Sequence length

135

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	G alpha (i) signalling events
Relaxin signaling pathway	Relaxin receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMBLYOPIA	—	GWAS catalog	30098192	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (16)
Anorexia	Anorexia	BEFREE	31780677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23438439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34680872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23438439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31545476, 34419055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34680872	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31780677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31780677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	28627638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34493981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27243554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23438439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32657028	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23438439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31348991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29956214		★★★★★ ★☆☆☆☆ Found in Text Mining only

INSL5 (insulin like 5)

Bookmark This Gene