IL22RA1 (interleukin 22 receptor subunit alpha 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 58985
• Gene name: Interleukin 22 receptor subunit alpha 1
• Gene symbol: IL22RA1
• Synonyms (NCBI Gene): CRF2-9, IL22R, IL22R1
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CR

miRNA Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029697	hsa-miR-26b-5p	Microarray	19088304
MIRT1064565	hsa-miR-125a-5p	CLIP-seq
MIRT1064566	hsa-miR-125b	CLIP-seq
MIRT1064567	hsa-miR-1265	CLIP-seq
MIRT1064568	hsa-miR-1910	CLIP-seq
MIRT1064569	hsa-miR-2277-3p	CLIP-seq
MIRT1064570	hsa-miR-3117-5p	CLIP-seq
MIRT1064571	hsa-miR-3152-3p	CLIP-seq
MIRT1064572	hsa-miR-3663-3p	CLIP-seq
MIRT1064573	hsa-miR-382	CLIP-seq
MIRT1064574	hsa-miR-3913-3p	CLIP-seq
MIRT1064575	hsa-miR-3938	CLIP-seq
MIRT1064576	hsa-miR-4269	CLIP-seq
MIRT1064577	hsa-miR-4302	CLIP-seq
MIRT1064578	hsa-miR-4319	CLIP-seq
MIRT1064579	hsa-miR-4477a	CLIP-seq
MIRT1064580	hsa-miR-4501	CLIP-seq
MIRT1064581	hsa-miR-4503	CLIP-seq
MIRT1064582	hsa-miR-4504	CLIP-seq
MIRT1064583	hsa-miR-4641	CLIP-seq
MIRT1064584	hsa-miR-4645-5p	CLIP-seq
MIRT1064585	hsa-miR-4673	CLIP-seq
MIRT1064586	hsa-miR-4732-3p	CLIP-seq
MIRT1064587	hsa-miR-4764-5p	CLIP-seq
MIRT1064588	hsa-miR-489	CLIP-seq
MIRT1064589	hsa-miR-542-3p	CLIP-seq
MIRT1064590	hsa-miR-670	CLIP-seq
MIRT1064591	hsa-miR-758	CLIP-seq
MIRT2015365	hsa-miR-1207-5p	CLIP-seq
MIRT2015366	hsa-miR-1827	CLIP-seq
MIRT2015367	hsa-miR-1909	CLIP-seq
MIRT2015368	hsa-miR-3194-3p	CLIP-seq
MIRT1064576	hsa-miR-4269	CLIP-seq
MIRT2015369	hsa-miR-4325	CLIP-seq
MIRT1064579	hsa-miR-4477a	CLIP-seq
MIRT1064581	hsa-miR-4503	CLIP-seq
MIRT1064584	hsa-miR-4645-5p	CLIP-seq
MIRT1064585	hsa-miR-4673	CLIP-seq
MIRT2015370	hsa-miR-4763-3p	CLIP-seq
MIRT2015371	hsa-miR-616	CLIP-seq
MIRT2015372	hsa-miR-940	CLIP-seq
MIRT2247677	hsa-miR-197	CLIP-seq
MIRT2247678	hsa-miR-412	CLIP-seq
MIRT1064576	hsa-miR-4269	CLIP-seq
MIRT1064579	hsa-miR-4477a	CLIP-seq
MIRT1064581	hsa-miR-4503	CLIP-seq
MIRT1064584	hsa-miR-4645-5p	CLIP-seq
MIRT1064585	hsa-miR-4673	CLIP-seq
MIRT2247679	hsa-miR-579	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004904	Function	Interferon receptor activity	TAS	10875937
GO:0005515	Function	Protein binding	IPI	12513909, 15120653, 18599299, 18675809, 20462497, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0042015	Function	Interleukin-20 binding	IEA
GO:0042018	Function	Interleukin-22 receptor activity	IEA
GO:0042018	Function	Interleukin-22 receptor activity	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0140865	Process	Interleukin-22-mediated signaling pathway	IEA

Other IDs

• MIM: 605457
• HGNC: 13700
• e!Ensembl: ENSG00000142677

Protein

• UniProt ID: Q8N6P7
• Protein name: Interleukin-22 receptor subunit alpha-1 (IL-22 receptor subunit alpha-1) (IL-22R-alpha-1) (IL-22RA1) (Cytokine receptor class-II member 9) (Cytokine receptor family 2 member 9) (CRF2-9) (ZcytoR11)
• Protein function: Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of t
• PDB: 3DGC , 3DLQ , 6DF3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01108	Tissue_fac	3 → 107	Tissue factor	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in colon, liver, lung, pancreas and kidney. No expression in immune cells such as monocytes, T-cells, and NK-cells. Expressed in keratinocytes of normal skin as well as in psoriatic skin lesion. Detected in normal blood brain
• Sequence:

  MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY
  GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT
  LKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLG
  GKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMG
  FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
  YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVG
  PPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS
  SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNV
  LHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPK
  DEAKSPAPETSDLEQPTELDSLFRGLALTVQWES

• Sequence length: 574

Pathways

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Interleukin-20 family signaling
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway

Related Genes

Sort by: Blended Diseases Pathways Evidence source

IL24 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor. IL19 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor. IL20 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor. IL20RA 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor. IL20RB 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IL24	0	[]	4	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","JAK-STAT signaling pathway","Interleukin-20 family signaling"]	0	[]
IL19	0	[]	4	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","JAK-STAT signaling pathway","Interleukin-20 family signaling"]	0	[]
IL20	0	[]	4	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","JAK-STAT signaling pathway","Interleukin-20 family signaling"]	0	[]
IL20RA	0	[]	4	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","JAK-STAT signaling pathway","Interleukin-20 family signaling"]	0	[]
IL20RB	0	[]	4	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","JAK-STAT signaling pathway","Interleukin-20 family signaling"]	0	[]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesIL24, IL20 Depression Linked via 2 of 5 related genesIL24, IL20 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesIL19, IL20RB Diabetes mellitus type 1 Linked via 2 of 5 related genesIL19, IL20 Inflammatory bowel disease Linked via 2 of 5 related genesIL19, IL20

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["IL24","IL20"]
Depression	2	["IL24","IL20"]
Attention deficit hyperactivity disorder	2	["IL19","IL20RB"]
Diabetes mellitus type 1	2	["IL19","IL20"]
Inflammatory bowel disease	2	["IL19","IL20"]