Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3605
Gene name	Interleukin 17A
Gene symbol	IL17A
Synonyms (NCBI Gene)	CTLA-8CTLA8IL-17IL-17AIL17ILA17
Chromosome	6
Chromosome location	6p12.2
Summary	This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molec

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016706	hsa-miR-335-5p	Microarray	18185580
MIRT734534	hsa-miR-122-3p	ELISALuciferase reporter assay	33230454
MIRT734536	hsa-miR-30a-3p	ELISALuciferase reporter assay	33230454
MIRT735527	hsa-miR-126-5p	Flow cytometryLuciferase reporter assayqRT-PCRWestern blotting	33365067
MIRT1063794	hsa-miR-1236	CLIP-seq
MIRT1063795	hsa-miR-1299	CLIP-seq
MIRT1063796	hsa-miR-153	CLIP-seq
MIRT1063797	hsa-miR-3664-5p	CLIP-seq
MIRT1063798	hsa-miR-448	CLIP-seq
MIRT1063799	hsa-miR-4714-5p	CLIP-seq
MIRT1063800	hsa-miR-606	CLIP-seq
MIRT1063801	hsa-miR-618	CLIP-seq
MIRT1063802	hsa-miR-875-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
HDAC11	Repression	21239696
NFKB1	Unknown	21243522
RELA	Unknown	21243522
RORC	Unknown	19578368

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002225	Process	Positive regulation of antimicrobial peptide production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IDA	12297109, 22727489
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	7499828
GO:0005515	Function	Protein binding	IPI	23695682, 25416956, 28827714, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	12297109, 22727489
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	7499828
GO:0006915	Process	Apoptotic process	TAS	7499828
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	7499828
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7499828
GO:0008219	Process	Cell death	TAS	8390535
GO:0009611	Process	Response to wounding	IDA	22727489
GO:0009611	Process	Response to wounding	IDA	22727489
GO:0009611	Process	Response to wounding	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	22727489
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	29734196
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	29734196
GO:0032739	Process	Positive regulation of interleukin-16 production	IDA	29734196
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	21145111
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21350122
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	29734196
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	9367539, 19825828, 20554964, 31376257, 35183823
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	12297109
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16982811
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	22727489
GO:0060729	Process	Intestinal epithelial structure maintenance	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0072537	Process	Fibroblast activation	IDA	21145111
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IDA	21350122
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0097530	Process	Granulocyte migration	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	29734196
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	IEA
GO:1903557	Process	Positive regulation of tumor necrosis factor superfamily cytokine production	IEA
GO:1903882	Process	Negative regulation of interleukin-17-mediated signaling pathway	IDA	23042150
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IDA	21350122
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IEA

MIM	HGNC	e!Ensembl
603149	5981	ENSG00000112115

Q16552

Protein name

Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)

Protein function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL

PDB

2VXS , 4HR9 , 4HSA , 4QHU , 5HHV , 5HHX , 5HI3 , 5HI4 , 5HI5 , 5N7W , 5N92 , 5NAN , 5VB9 , 6WIO , 6WIR , 7AMA , 7AMG , 7UWM , 7UWN , 7WKX , 7Z2M , 7ZAN , 8B7W , 8CDG , 8DY1 , 8DY5 , 8DYF , 8DYG , 8DYH , 8DYI , 8USR , 8USS , 9FKX , 9FL3 , 9H4D , 9H4O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06083	IL17	69 → 147	Interleukin-17	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in memory Th17 cells (at protein level). {ECO:0000269|PubMed:17763419}.

Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Sequence length

155

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AZOOSPERMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE DERMATOMYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

IL17A (interleukin 17A)