IFNG (interferon gamma)

Gene

• Entrez ID: 3458
• Gene name: Interferon gamma
• Gene symbol: IFNG
• Synonyms (NCBI Gene): IFG, IFI, IMD69
• Chromosome: 12
• Chromosome location: 12q15
• Summary: This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor w

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2069707	G>A,C	Drug-response	Upstream transcript variant
rs34079299	TGTGTGTGTGTG>-,TG,TGTG,TGTGTG,TGTGTGTG,TGTGTGTGTG,TGTGTGTGTGTGTG,TGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTGTG,TGTGTGTGTGTGTGTGTGTGTGTGTG	Risk-factor	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006912	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006913	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT006914	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR	22379033
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	22772450
MIRT007285	hsa-miR-409-3p	Luciferase reporter assay	23360331
MIRT029122	hsa-miR-26b-5p	Microarray	19088304
MIRT437825	hsa-miR-125a-5p	ELISA, Microarray, qRT-PCR, Western blot, silico analysis	24759737
MIRT437970	hsa-miR-24-3p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437969	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437970	hsa-miR-24-3p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437969	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	24704866
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT437945	hsa-miR-27a-3p	ChIP-seq, qRT-PCR, Luciferase reporter assay, Western blot	24725595
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	27812842
MIRT007034	hsa-miR-29b-3p	Luciferase reporter assay	27812842
MIRT1060884	hsa-miR-1305	CLIP-seq
MIRT1060885	hsa-miR-340	CLIP-seq
MIRT1060886	hsa-miR-3941	CLIP-seq
MIRT1060887	hsa-miR-4330	CLIP-seq
MIRT1060888	hsa-miR-466	CLIP-seq
MIRT1060889	hsa-miR-4672	CLIP-seq
MIRT1060890	hsa-miR-4731-3p	CLIP-seq
MIRT1060891	hsa-miR-4801	CLIP-seq
MIRT1060892	hsa-miR-607	CLIP-seq
MIRT2246419	hsa-miR-34c-3p	CLIP-seq
MIRT2389279	hsa-miR-664	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Activation	12836278;18641343;20006311;20304822
ATF3	Activation	20304822
CREB1	Activation	20006311;20685939
CREB1	Repression	11907114
CREB1	Unknown	7759501
EGR1	Unknown	8900159
EOMES	Unknown	20056084
EP300	Activation	12836278
GATA1	Unknown	12836278
GATA3	Unknown	21507199
IRF1	Activation	13678429
JUN	Activation	12626576;18641343;20006311;20304822
JUN	Unknown	12836278;7759501
MSC	Activation	19561533
MYCN	Unknown	9570357
NFATC1	Unknown	12836278
NFATC2	Unknown	12836278
NFIL3	Unknown	7565758
NFKB1	Activation	17407192;18690006
NFKB1	Unknown	21243522;9374532
PARP1	Unknown	17177976
PROX1	Repression	20064070
RELA	Activation	17407192;18690006
RELA	Unknown	21243522;9374532
RFX5	Unknown	12968017
STAT1	Activation	13678429
STAT1	Repression	15055356;18616672
STAT1	Unknown	16195385;20004484
STAT3	Repression	18616672
STAT4	Unknown	9558063;9642277
STAT5A	Activation	15528362
STAT5B	Unknown	15528362
TBX21	Activation	17541280;19348920;20977921;21540308
TBX21	Unknown	12938094;16498264;16737784;17705132;19879772;20056084;21507199;22521571;24752800
TFAP4	Unknown	12836278
USF1	Unknown	8900159
YY1	Activation	8756632
YY1	Repression	8756632
YY1	Unknown	12836278

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	IGI	7715705, 19808651
GO:0001774	Process	Microglial cell activation	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	30634164
GO:0002250	Process	Adaptive immune response	IBA
GO:0002281	Process	Macrophage activation involved in immune response	IDA	30634164
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	10652336, 22184754
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	16914093
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS	26227742
GO:0005133	Function	Type II interferon receptor binding	IEA
GO:0005133	Function	Type II interferon receptor binding	TAS	10477596
GO:0005515	Function	Protein binding	IPI	7617032, 11250200, 18252829, 28514442, 33961781
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	16914093, 33706478
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	IGI	7828849
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10477596
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	22002246
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009615	Process	Response to virus	IDA	16280321
GO:0010508	Process	Positive regulation of autophagy	IDA	23629966, 26347139
GO:0010628	Process	Positive regulation of gene expression	HDA	11487543
GO:0010628	Process	Positive regulation of gene expression	IDA	20164187
GO:0010628	Process	Positive regulation of gene expression	IDA	19423618, 20209097, 22504299, 23817958
GO:0010628	Process	Positive regulation of gene expression	IGI	19808651
GO:0010628	Process	Positive regulation of gene expression	IMP	20889566
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	23817958
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010634	Process	Positive regulation of epithelial cell migration	IDA	11698262
GO:0030225	Process	Macrophage differentiation	IDA	30634164
GO:0030857	Process	Negative regulation of epithelial cell differentiation	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	22504299
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	18501882
GO:0032722	Process	Positive regulation of chemokine production	IDA	19423618
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	7605994, 8557999
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	20027291
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	30634164
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	7715705
GO:0032834	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response	IDA	20209097
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	16280321
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IDA	7544003
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	22844114
GO:0038196	Process	Type III interferon-mediated signaling pathway	IDA	20015550
GO:0038196	Process	Type III interferon-mediated signaling pathway	IDA	16914093
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	22504299
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	16280321
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	ISS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	16220542
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045821	Process	Positive regulation of glycolytic process	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	23629966
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048143	Process	Astrocyte activation	IDA	18375019
GO:0048143	Process	Astrocyte activation	ISS
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050729	Process	Positive regulation of inflammatory response	IDA	30634164
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IGI	19808651
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051050	Process	Positive regulation of transport	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IDA	28883123
GO:0060333	Process	Type II interferon-mediated signaling pathway	IDA	16914093, 22504299, 23629966
GO:0060333	Process	Type II interferon-mediated signaling pathway	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IGI	19808651
GO:0060333	Process	Type II interferon-mediated signaling pathway	NAS	14525967, 15864272
GO:0060552	Process	Positive regulation of fructose 1,6-bisphosphate metabolic process	IDA	9282826
GO:0060557	Process	Positive regulation of vitamin D biosynthetic process	IDA	9282826
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	22504299
GO:0090312	Process	Positive regulation of protein deacetylation	IDA	23629966
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	15604419
GO:0098586	Process	Cellular response to virus	NAS	14525967, 15864272
GO:0150076	Process	Neuroinflammatory response	ISS
GO:1900222	Process	Negative regulation of amyloid-beta clearance	ISS
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	ISS
GO:1901857	Process	Positive regulation of cellular respiration	ISS
GO:1902004	Process	Positive regulation of amyloid-beta formation	IGI	19808651
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	HDA	11487543
GO:1903543	Process	Positive regulation of exosomal secretion	HDA	11487543
GO:1904440	Process	Positive regulation of iron ion import across plasma membrane	ISS
GO:1904798	Process	Positive regulation of core promoter binding	IDA	23629966
GO:2000309	Process	Positive regulation of tumor necrosis factor (ligand) superfamily member 11 production	IDA	16220542

Other IDs

• MIM: 147570
• HGNC: 5438
• e!Ensembl: ENSG00000111537

Protein

• UniProt ID: P01579
• Protein name: Interferon gamma (IFN-gamma) (Immune interferon)
• Protein function: Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed:16914093, PubMe
• PDB: 1EKU, 1FG9, 1FYH, 1HIG, 3BES, 6E3K, 6E3L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00714	IFN-gamma	15 → 153	Interferon gamma	Domain

• Tissue specificity: TISSUE SPECIFICITY: Released primarily from activated T lymphocytes.
• Sequence:

  MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
  EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
  YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

• Sequence length: 166

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acquired immunodeficiency syndrome, rapid progression to	Pathogenic	rs2069709	RCV000015845	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 69	Pathogenic	rs1882625482	RCV001250909	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA, APLASTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic anemia	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet ClinVar, Disgenet ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
APLASTIC ANEMIA, IDIOPATHIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic anemia, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APPENDICITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, INFECTIOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA TELANGIECTASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIOLITIS OBLITERANS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARREST	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC GRANULOMATOUS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY OF GLUCOSE-6-PHOSPHATE DEHYDROGENASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTURBANCE IN MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYELID DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C virus infection, response to therapy of	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC APLASTIC ANEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFECTIVE ARTHRITIS OF SHOULDER REGION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, MUCOCUTANEOUS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE SYNDROME 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycobacterium tuberculosis, protection against	protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAUSEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECT, FOLATE-SENSITIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS X-LINKED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEURAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS, ALLERGIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICHURIASIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tsc2 angiomyolipomas, renal, modifier of	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBEROUS SCLEROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBEROUS SCLEROSIS 2	—	CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBEROUS SCLEROSIS COMPLEX	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING ANKLE AND FOOT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING FOREARM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING HAND	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING LOWER LEG	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING PELVIC REGION AND THIGH	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING UPPER ARM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESICO-URETERAL REFLUX	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	26110930	Associate	★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	16634796, 8349943		★☆☆☆☆ Found in Text Mining only
Acrania	Acrania	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	18715881		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15606547, 20943267, 21067287, 23075808, 27397551, 28295300, 28782144, 30212785, 30443842		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30747087		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	24463810		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28375949, 29517628		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10602416, 19393234, 19965687		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	22617429		★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	PSYGENET_DG	22623148		★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	BEFREE	9075278		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10371355, 15254047, 25383957, 28526810, 31827180		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15870936		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10389988, 8590319		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27777774		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30040527		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24055710, 26428847, 27440266, 29516506, 30014971, 30824332, 30972766, 7657294		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19152246, 27637085		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15833880		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25383957, 25695667		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25383957		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25079795, 31635070		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	17622250, 35322867	Associate	★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	26014098		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	CTD_human_DG	16319717		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	28319253, 28722826		★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	CTD_human_DG	16319717		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21067287, 27397551, 28295300, 30212785, 30443842		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	9766506		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23487038		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	14959851, 18077789, 28571489		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	16607283, 27463676		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15871724, 29794791		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	23962110		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19953283, 28652434, 30367666		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25363549		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	12608917, 18672993, 21198753, 9802707		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	10452776, 20924287, 22186238, 26155922, 28214951, 28577221, 29982264, 30481581, 30612129, 30803044, 30851706, 31269820		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	27191524, 28418931, 29083474, 30131581, 30558963		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	LHGDN	17021766		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	27191524, 28418931, 29083474, 30131581, 30558963		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33206953, 35139885, 35283023, 40121165	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	15660915		★☆☆☆☆ Found in Text Mining only
AMELOGENESIS IMPERFECTA, HYPOPLASTIC/HYPOMATURATION, X-LINKED 1	Amelogenesis Imperfecta, X-Linked	BEFREE	29358858		★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	20065129	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26048613		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28761285, 31615568		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21072055, 22015310, 30457201		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29246232	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32246039, 37582053	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36359827	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis type 6	Amyotrophic lateral sclerosis	Pubtator	37582053	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30953519		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28730964		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	23904164	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	11522534, 28282547, 28426727, 9844760		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	12819637		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	23045477, 24336657, 28426727, 39962550	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11843845, 12149196, 12750172, 14675414, 15327519, 15345281, 1586705, 16131564, 16434488, 17373677, 19109204, 21506940, 22797698, 26214243, 28459238, 34220798, 35274786, 36334505	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	12404285, 26764034	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10641497, 12152923	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17654682, 33776989	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21953592	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital	Anemia	BEFREE	11522534		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17654682, 20477883, 29926339		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	30686933, 7962625	Associate	★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	16409458	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28260995, 29554212	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	10869258, 25760478, 30416509, 30631648		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	29100307		★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	BEFREE	15604887		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11114280, 15479754, 16947381, 18512784, 19079222, 24174363, 28843049, 30057583		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	18512784		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	39778225	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22024742, 30685120, 30782607		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29775631		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11774563		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	22859583, 30296466, 31450770		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30687319, 30872365	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30872365		★☆☆☆☆ Found in Text Mining only
Antisynthetase syndrome	Antithrombin deficiency	Pubtator	30886734	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20811799		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20811799, 29028592		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	16297165	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	30782482		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	16297165, 20226696, 30686933, 32138469	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	30957625	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	38484620	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15254597, 17182953, 28602894, 30782482		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31427887	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	30810667	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25935003		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	34935306	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39986193	Associate	★☆☆☆☆ Found in Text Mining only
Aphakia, congenital primary	Congenital primary aphakia	BEFREE	29649772		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	15327519, 1586705, 16131564, 16434488, 20934357, 20953611, 21506940, 21561401, 22800824, 23334427, 25248876, 25342713, 26214243, 30361263, 31141802, 31287345, 31668371, 8639773		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Aplastic Anemia	Aplastic anemia	GENOMICS_ENGLAND_DG	15327519		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Aplastic Anemia	Aplastic anemia	LHGDN	18485114		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Aplastic Anemia	Aplastic anemia	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Aplastic Anemia	Aplastic anemia	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Aplastic anemia, idiopathic	Anemia	ORPHANET_DG	15327519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic anemia, idiopathic	Anemia	BEFREE	25383872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Appendicitis	Appendicitis	CTD_human_DG	16367942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	11934839	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	14734640, 15372109, 17363708		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15507847, 15907820, 17255531, 1729692, 18586252, 20655098, 21346151, 23800176, 25196434, 25478796, 25740578, 26520896, 26667768, 28646427, 29062018, 30051926, 30223437, 30283459, 30290963, 30473441, 30872365, 31231385, 31480861		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12974768, 16947381, 17469140, 17713715, 19031096, 19035513, 2174906, 22269151, 22833339, 22930199, 23630349, 24368568, 25113810, 25253467, 25727209, 28438552, 29218573, 29228301, 29330323, 29339199, 29980684, 29992549, 30254309, 30285515, 30748031, 31438735		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17179173, 17393419, 24315997, 25113810, 33168080	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17713715, 18506884		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	1914237, 31260948	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	36190378	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	10765921, 17002793, 26747737, 27159026, 30089725, 32787920, 35860254	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	15482477, 16323244, 22277938, 25512250, 27496874, 27543964, 29980703, 7693825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16741508, 37893484	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	2476168, 9201310	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	15547094, 18062835, 8078923	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10343540, 10606983, 10692038, 10733472, 10931160, 11056676, 11219392, 11229457, 12115225, 12165096, 12562402, 12847679, 1347492, 14558082, 15140775, 15248214, 1534001, 15535835, 16838043, 17032244, 17392348, 17824960, 17907168, 18505427, 18506884, 19104082, 19370184, 19703021, 20615213, 20824142, 21953607, 22594821, 23045162, 24690414, 25430993, 26604133, 27294146, 27487156, 28239238, 28866647, 29066221, 29423382, 29933531, 30092847, 30402903, 30718650, 30718719, 30890897, 3127092, 31992083, 32246007, 32377535, 32561292, 33066816, 33362761, 34239365, 34369364, 34435471, 34895310, 35023427, 36062760, 37496411, 37934808, 38168669, 38275742, 38283352, 38372731, 39261837, 40243636, 7657832, 8608632, 9691097, 9771211	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11168012, 16572447, 23255246, 2827831	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12780697, 15022319, 16220542, 1914237, 32245307, 32868411, 32961930, 34301999, 38123480	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	16947381, 28461105, 28554321, 28965181		★☆☆☆☆ Found in Text Mining only
Arthritis, Suppurative	Suppurative arthritis	CTD_human_DG	19203382		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis	Pubtator	39198650	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	26521731, 26546777, 31249576		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10225979, 10452776, 11413353, 11703360, 12061423, 17127048, 17386028, 17532201, 18780949, 19217272, 20371397, 21179211, 21798578, 22192168, 23535363, 26092996, 27445529, 28373098, 28424066, 29809062, 32108047, 32240371, 33852838, 34127671, 35578269, 37865742, 7807013, 9811173	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10228104, 10353570, 10452776, 11699731, 12061423, 12209087, 12913068, 14767694, 15123769, 16961714, 17361521, 17532201, 18004650, 18385742, 18849613, 21205293, 21637953, 21798578, 22143036, 22151743, 22186238, 22192168, 23535363, 24033084, 24107080, 24167151, 24450480, 24450586, 24588865, 24995662, 25345302, 25530133, 26108069, 26121748, 27679954, 28346792, 28480606, 28515358, 28524369, 28628664, 28679952, 28824424, 28831046, 29402723, 29431692, 29453280, 29498435, 30051941, 30233198, 30290688, 30359762, 30400588, 30474283, 30475388, 30537802, 31531069, 7742012, 8564096, 9087947, 9433936		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12209087, 17532201, 18385742		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16449261, 17947510, 24450586	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21197090, 24107080, 24428972, 34331994	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma Occupational	Asthma	Pubtator	23535363	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10187764, 19740103	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11156954, 1445220, 1601980, 1906070, 20888416, 7519632, 8103050, 8552275, 9003247, 9065411		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	9065411	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	17100756, 2172158, 31819434, 34737749, 35977003	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23529012, 26618646, 28056107	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	11714861, 11805151, 11934839, 17485888, 18586252, 18793716, 19443843, 21346151, 21646352, 2492403, 25196434, 25478796, 26071079, 29062018, 30223437, 34082770, 35784287	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	15507847, 15907820, 17255531, 1729692, 18586252, 20655098, 21346151, 23800176, 25196434, 25478796, 25740578, 26520896, 26667768, 28646427, 29062018, 30051926, 30223437, 30283459, 30290963, 30473441, 30872365, 31231385, 31480861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	33874983	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	9169506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31813744		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	38004107	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27184921		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27184921		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19509467	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	18762240, 22226452, 31123562, 31616420, 37545517	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37108638	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18762240, 25912394, 27217154, 31728886		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	16360218		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23231720, 32875100	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	28099628, 30941018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	20884299, 22371007, 28257599, 29288086, 30735937, 8076766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11037964, 11727511, 12890422, 14758107, 15068623, 15661020, 1627786, 16434488, 17514769, 19015307, 19641142, 20036577, 20167631, 20977921, 21802166, 22132895, 22406048, 22424783, 22809281, 23190644, 23243276, 23630349, 23727609, 23777204, 24583068, 25541140, 25707685, 25727209, 26703437, 26885859, 27173733, 27312110, 27429419, 28095433, 28167631, 28248972, 28285814, 28405624, 28453771, 28587079, 28637904, 28640379, 28673589, 28736298, 28982122, 29191572, 29275836, 29523850, 29691398, 29704668, 29921905, 29925830, 30680474, 30728325, 31092922, 31112138, 3121358, 31396202, 31699819, 31745335, 8476573, 9848715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	16434488, 17928893, 18505427, 18782261, 22113482, 23243276, 23777204, 23891168, 25935003, 26171588, 27159026, 27312110, 27429419, 28444759, 28736298, 28982122, 30021835, 31396202, 31898601, 34424567, 35693814, 36833193, 37213666, 7964459	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	19077085, 9647229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	33705988	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	34650558	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	24030736	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	12406097		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	33059348	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	19797122, 20586818, 20929277, 29434699		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28761285, 31615568		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20372104, 23872144, 25427612, 25449106, 25492700, 26983850, 31025923		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10403909, 19245431, 19757192		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11889061	Stimulate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	30527631		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10513814, 10594567, 15196263, 15654836, 15654837, 18685727, 23336215, 25982097, 27222359, 29854829, 37003592	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15248229, 21334264, 22197901, 22385240, 24064012, 24973639, 25056541, 26222305, 27222359, 28414558, 28780618, 29600486, 31122907		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15248229, 15545055, 17056573, 20508866, 22385240, 25303043, 29534057, 39838177	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	15501397, 18579762		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10705309, 11992619, 28558037, 6426791		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171, 34399367	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10519993, 32581238	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	12457789, 16819397, 19756986, 21857377, 27636194, 29748604		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911, 29748604	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21728784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21728784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	29032575	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	37058046	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	38484669	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	23295883	Associate	★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	BEFREE	24379648		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10197441, 11219496, 16094077, 19202079, 19489682, 25236570, 29435122, 30425515, 6426791, 7621243, 8459207		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	23275297		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	26658659	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23133532, 24611731, 29473714	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29473714, 30008722		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	36077598	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19497133	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	12750172, 16131564, 17379072, 21659535, 7579440	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	16131564, 30803992		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	37993664	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28543773, 29168181	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases	Brain disease	Pubtator	9143252	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases Metabolic Inborn	Brain disease	Pubtator	19095956	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30355926		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19497133, 30189044	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19944968, 22996231, 29970101, 30189044		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33420630	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10216096, 10651943, 11129984, 15181474, 15735741, 15931634, 16219472, 16267208, 16721044, 1768061, 18494001, 19580338, 21323572, 21409596, 22095765, 22333315, 22624006, 22699677, 23053995, 23650543, 24164868, 24475282, 24551119, 25051917, 25335731, 26397740, 26563945, 27050072, 27573075, 28388578, 28400477, 29054490, 29156701, 29185091, 29478965, 29746817, 30018709, 30082828, 30336781, 30614229, 30657766, 31428522, 31666931, 7621246, 8287600, 9038615		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19446661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10651943, 11936954, 14651776, 14993214, 15241475, 15365776, 15931634, 16116176, 17261184, 17697357, 19451644, 20418110, 20457620, 2109997, 21453513, 22333315, 22624006, 24475282, 25217158, 26011589, 26063617, 26805406, 26918940, 27050961, 27097643, 29185091, 30336781, 30579865, 30814616, 30957844, 31081058, 31932876, 31981982, 32265897, 32560316, 32618109, 32649310, 32722549, 33003293, 33268347, 33304345, 33667790, 33767579, 33879226, 33968037, 34265738, 34572592, 35014681, 35355749, 35639264, 36766731, 37081323, 37106127, 37169743, 37643511, 37685980, 39736012, 8609251	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22563434, 30657766	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bright Disease	Bright Disease	CTD_human_DG	1825860		★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	21340626		★☆☆☆☆ Found in Text Mining only
Broca Aphasia	Broca Aphasia	BEFREE	31105510		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28559466		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	36229050	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	10228104, 18286551, 19773677, 25130433, 29688024, 30290688		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	32628310, 36561744	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	35228282	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	9573240	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	12451269, 28118023, 7544620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	12451269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis Obliterans	Bronchiolitis Obliterans	CTD_human_DG	16137903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis, Exudative	Bronchiolitis	CTD_human_DG	16137903		★☆☆☆☆ Found in Text Mining only
Bronchiolitis, Proliferative	Bronchiolitis	CTD_human_DG	16137903		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	16754651	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23470621, 29354129		★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Stimulate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	11433390, 22289994	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	31450770		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28761292		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1322203, 21392167		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28033393	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	32832566	Inhibit	★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli Ulcer	BEFREE	11469950, 28241036, 30090691		★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	28241036	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	28431214	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31034990	Stimulate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216, 33037017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25921106, 35341013	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11129984, 27687006, 28891951, 29133416, 31394808, 8826937, 9486814		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	27575372	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21980389, 28829805, 8450029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	22808251	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27903846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	9420627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14690454, 16785570, 17711513, 19126646, 21419713, 22056812, 22505239, 22634051, 23423978, 23940564, 26757951, 26893439, 27279136, 27321064, 27832318, 29033545, 29706626, 30264546, 31388642, 31442209, 31724091, 31870124, 32148378, 32704163, 33099927, 33180829, 33891607, 34181338, 34777920, 35390227, 36279983, 36674931, 36960063, 37254046	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25169554	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29666149	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	20084279, 22327783		★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	26965581	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34968501	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10197441, 11219496, 16094077, 19202079, 19489682, 25236570, 29435122, 30425515, 6426791, 8459207		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28294085		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15095306, 15603851, 16418217, 1680858, 17348819, 18497994, 20814891, 23152000, 23937717, 24971369, 26300426, 26719671, 28731226, 28748356, 28912137, 29408308, 29516506, 29666465, 29898990, 29946223, 30214604, 30297515, 30824332, 30953795, 31190880, 31362929, 31501431, 31787530		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21829534	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29343207, 32495519, 39176093, 39256468, 39684873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10431690, 1356627, 15578685, 17622250, 19238009, 22493490, 23696916, 24777966, 26587829, 32469992, 32495158, 33177244, 33589528, 34789838, 34795663, 35184226, 35341013, 36059531, 36091050, 36932108, 37545223, 39884574, 7905278	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10491412, 35759229, 8004818	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10944605	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	33248321	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10086856, 10383748, 10506169, 11710944, 19516264, 22402444, 28526810, 32265897, 40005446	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27169370	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	16283306	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21980389, 28829805		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11860540, 1457511, 17634541, 18559537, 18976739, 23873689, 24141405, 29069020, 30639700, 9649178		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	22024742, 28159747		★☆☆☆☆ Found in Text Mining only
Cardiac rhabdomyoma	Cardiac rhabdomyoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	12404285	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17556594, 30426505		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28026044, 33705988	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	BEFREE	14522416		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	21422001	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	28207945	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	35328083	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21646352, 23077565, 33172487, 35977003, 38152968	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21814463, 29903989		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27992360, 36693381	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	27782101	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	30872365	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25196434	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	19285161	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22410565, 30262982		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	25303043	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	27956727		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	10548367, 11908704, 12472679, 12477758, 15215891, 15247173, 15324937, 15490153, 15591503, 15979955, 16284791, 16773129, 17324400, 17965065, 24325470, 24971453, 25131137, 25190711, 25915602, 26440733, 26444573, 26655133, 27936497, 28148736, 28673589, 30240467, 31505020, 31809599, 7926902, 9721152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	12759242, 21288140, 23134879, 23844808, 25915602, 28934294, 30097691, 32612145, 35705047, 38040898	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	15324937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	24971453	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Nervous System Diseases	Central nervous system disease	Pubtator	39364412	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	23121407		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28848179		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23286717	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35856366	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28783533, 31105510, 31813744		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	25243172	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18337305, 19681846, 19959217, 21503915, 25106529, 25208560, 25649976, 25921106, 28378632, 9159336		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	19232001, 22327783, 23521696, 23652797, 25106529, 25208560		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18337305, 19681846, 19959217, 25106529, 25208560, 25649976, 25921106, 28378632, 29608425, 9159336		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	30559742, 33660144, 34592495, 34867992, 37088297	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	16299288, 25144227, 30517089, 31669531	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12357356, 15496974, 21067287, 27397551, 28295300, 30212785, 30443842		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	9766506		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	21798578, 24709010, 29863910		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	30527631		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	16607283, 27463676		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	14578204		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15794670, 18069763, 31976810, 32653521, 33737613	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	24040208		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28383652	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28597951, 37256725	Associate	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	29748604		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	30039470		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	27172898	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10329350, 12748124, 28054346		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	17237409		★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	23295883, 27081842, 30081671		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	15604887		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28384257, 29944680		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	31072323	Associate	★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	8728018		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	10454340, 10695656, 10828042, 11435314, 18277931, 1846940, 18972195, 1934607, 20511543, 23526099, 25052001, 27666509, 27707882, 27873163, 2821069, 2838754, 2838849, 2839459, 2839835, 28558308, 28982143, 29886069, 30050527, 30260027, 31233057, 31446487, 31681257, 8673477, 8975873, 9129047		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic heart failure	Heart Failure	BEFREE	21418620		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	1942774, 20303284, 29868028, 30231948, 31794765		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24347824, 29229532, 29337019, 29482513, 31549627		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10403909, 19245431, 19757192, 21406718, 27015189, 27590344, 29315094, 31724172		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15182335		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21814463, 22352763, 24805101, 28830544, 28934595, 29872287, 30349227, 30952808, 31060902, 31078066, 31349846		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	16677285, 18672993, 20932510, 20958339, 27019379, 30427403, 30755190		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	17209781		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	20958339, 21198766, 24670840, 25530681, 28364573	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	30304122, 30427403	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	27876593		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	26399381		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22840853		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	37028702	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10491339, 10719024, 31170723, 8076766		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	25139022, 25579819	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866, 34646402	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29113698, 29724230		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29175260		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29206475	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33324408	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	35283023	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10450519, 16949315, 17631136, 21693591, 21994045, 22610884, 22796792, 24367025, 25100292, 25588868, 26153869, 27479742, 28098246, 28506689, 29228157, 29387864, 29416538, 29672155, 29728642, 30083167, 30214011, 30265974, 30333822, 31031628, 31249571, 31572375, 31632588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	24548422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	25071069	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	34147519, 37462681	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Collagenous	Collagenous colitis	Pubtator	31131860	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Microscopic	Microscopic colitis	Pubtator	16775121	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Microscopic	Microscopic colitis	Pubtator	27672296	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11167992, 18160345, 19318319, 20345984, 20547854, 25397893, 7664489, 9824577	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12974765, 17170025, 19309553, 20848535, 21818367, 25171510, 26698117, 26900298, 27152519, 28453768, 31191543, 8100205	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24450998	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	23566938		★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	9933455	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10371355, 10608348, 11911240, 16928387, 21530489, 22037870, 2451518, 25735954, 28159747, 30122999, 30439686, 30770385, 30824815, 31348591, 31632588, 7728775, 8474431, 8912533, 9649586		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21859832	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10389988, 10899312, 11761438, 1373349, 14500642, 15063730, 19074829, 19476491, 24121019, 33891607, 34389618, 36756126, 7728775, 8306368	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	10866311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29109732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	3124115, 9472684	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19863607, 21515097, 22028324, 22089087, 22699929, 22781631, 23042300, 24040001, 25225903, 25358689, 25383957, 25671296, 25695667, 27687006, 27777774, 28811964, 29344268, 29690889, 29801973, 30406373, 30736857, 31233057, 31788072, 31824844		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11173732, 15188028, 16367922, 16630022, 20816019, 21859832, 22363134, 22781631, 24040001, 25076849, 25225903, 25358689, 25875151, 26837580, 26957265, 27619682, 27687006, 28210081, 28627973, 29061646, 29096354, 31061070, 31221124, 31678770, 31735170, 32265897, 32363121, 32641473, 32670264, 33237662, 33628843, 34758826, 34768077, 35208526, 35262923, 35681225, 35720311, 35979362, 36669486, 36700211, 36773295, 36869093, 37565053, 37931529, 37991387, 38073330, 39739032, 8910434, 9042431	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16367922		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17160410, 2141333, 38178618	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	2119252		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38159250	Stimulate	★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	8419187		★☆☆☆☆ Found in Text Mining only
Combined Saposin Deficiency	Combined saposin deficiency	Pubtator	24373350	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	16634796, 19339796, 24582167, 27288995, 28554560, 8349943		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	16634796, 20629103, 26684629, 32057767, 34146579, 34247288	Associate	★☆☆☆☆ Found in Text Mining only
Complement component 3 deficiency	C3 Deficiency	BEFREE	28444847		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	12858406, 15138116, 21505270, 23043388, 23395622, 25045829, 25371014, 25977358, 26376789, 26526193, 26728971, 26809262, 28041935, 28237828, 29276096, 30016182, 30702196, 30832595, 8706330		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	34413849	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	29771971		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	29771971		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	10477731		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	12457789, 16819397, 19756986, 21857377, 27636194, 29748604		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28719954, 29088737		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1L	Congenital disorder of glycosylation	Pubtator	29589181	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	22192885, 22677194		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20938210, 3091246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	21418620, 29437117, 31501486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conjunctival Diseases	Conjunctival Diseases	BEFREE	26618646		★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	26618646	Associate	★☆☆☆☆ Found in Text Mining only
Constrictive Bronchiolitis	Constrictive Bronchiolitis	CTD_human_DG	16137903		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	22914497, 30630090		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10048768, 10537342, 10849555, 12930377, 14602239, 1606987, 22132887, 25109451, 26253654, 7490887		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	23750216		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	23750216	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	27124053	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22189538, 23199516, 24002640, 26520896, 26667768, 29860106, 31140911, 31141710, 31326419		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12972116, 21524750, 21841301, 22189538, 23199516, 26667768, 28985621, 29860106, 30416509, 31140911, 31141710, 31326419		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19255340, 21307941, 21841301, 22780915, 27124053	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	16409458, 35345521	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24167372	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22189538, 23159874, 23199516, 26667768, 29860106, 31140911, 31141710, 31326419		★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	28679952		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	23639073		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	23768082, 34719421	Inhibit	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	22342787	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22840853, 24119601, 28234665, 29953319, 30804419, 31128376		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33041191, 34346720	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10207725, 10657017, 11515847, 12876555, 15674109, 15827446, 16306764, 19079222, 19654324, 20626296, 21115548, 21945121, 21994045, 22671596, 22847681, 23176201, 23446770, 23575333, 24412990, 24776844, 25171510, 25359546, 25899824, 25935003, 26072972, 26698117, 27622767, 28139755, 28400196, 28476379, 29031634, 29209130, 30134230, 30584414, 30665494, 31077582, 31151823, 8436398, 9207269, 9327364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	10719056, 18160345, 19318319, 19333939, 26072972, 30029674, 7664489	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	17444956, 17682002, 18497880, 18633626, 18825772, 1902808, 19273624, 20848535, 21155006, 22671596, 25171510, 26377844, 26937622, 27622767, 28586085, 31321245, 32180132, 33266022, 37550393, 37586415, 38517030, 39332767, 9060820	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	18287963, 18497880		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	22167015, 24450998, 24943399	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	18775023		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	24773462		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12394188		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	27757545, 31846412		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10596703, 10844532, 12221127, 14525626, 15107292, 15463896, 16206514, 19399182, 20339685, 22729230, 25706389, 36480571	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15373916	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15463896, 25146850, 31134053		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16487026		★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	31601865		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	28433069		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	34876093	Associate	★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Dacryocystitis	Pubtator	27358392	Associate	★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Dacryocystitis	Pubtator	35662094	Stimulate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30456926		★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	31013450		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11508579, 14872492, 15290728, 16846535, 22380539, 24690414, 25937557, 28112376, 29258393, 30283333, 31438735		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26645352, 31271845, 31805674		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	28543773		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27995575	Stimulate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31414991		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	38452989	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	10359806, 29518260	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30356717		★☆☆☆☆ Found in Text Mining only
Dentinogenesis Imperfecta	Dentinogenesis Imperfecta	BEFREE	9084665		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12084660, 20811799, 21161299, 27049572, 28161475, 29028592, 29543650, 31170723, 31284015, 31450770		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	18276105	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32998701	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	37058046	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	37058046	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	20795427, 8823363	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21332458, 21437440, 23980846, 25172501, 26100037, 28672978, 29038621		★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	10384911, 27383320	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	19785613, 20795427	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	10620139, 10844552, 11989619, 1401997, 1714926, 1721013, 23600999, 24008422, 27304428, 29803800, 32035984, 34208434, 38131377, 38302650, 8082304, 8082305, 9409644, 9496691	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11703360, 18981165, 22427475, 26682905, 9030880, 9158100	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24518112, 33807704, 33975024, 35743310	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	16166103, 17179689, 19639725	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	11312644, 12484431, 15347381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	20008129, 8752660, 9187837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	10844552, 15149503, 15660915, 17596153, 21458658, 22000570, 22113474, 22445417, 22914497, 23454147, 23980846, 24008422, 24499290, 24996260, 26100037, 27543731, 27554821, 27639070, 28672978, 28990098, 29144049, 29353040, 29355930, 30223113, 30688372, 30729380, 30795812, 31036853, 31338033, 31515807, 7905045, 8040343, 8082304, 8082305, 9158100, 9199876, 9201310, 9933413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	12473063, 16689860		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	14675183, 15560761, 15804234, 1906894, 22914497, 22992805, 27376863, 30527631, 31519333, 7686190		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	15829578	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19953283, 28652434, 30367666		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19953283, 22235269, 34983619, 35436746, 36622131, 9212734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	28652434	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30552836		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32875100	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16369773, 17143605, 17534268, 19224196, 19712989, 20811799, 23486342, 23737756, 24595557, 27342127, 27459384, 27986673, 28028821, 28056894, 28235154, 28778049, 29396206, 29433065, 29482513, 29501767, 29577560, 29843700, 29903989, 30555479, 30643923, 31053128, 31367948, 9058314		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36203592	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11309160, 32763913	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11681488, 16717396, 26268591, 31032897, 33727573, 34181338	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12153522, 25363329, 28454543, 32265833, 34283808, 34951048	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16369773, 17143605, 17534268, 19224196, 19712989, 20811799, 23486342, 23737756, 24595557, 27342127, 27459384, 27986673, 28028821, 28056894, 28216665, 28235154, 28299976, 28778049, 28873085, 29396206, 29433065, 29482513, 29501767, 29577560, 29843700, 29903989, 30127212, 30260038, 30398041, 30555479, 30643923, 31053128, 31227229, 31367948, 31515869, 31574092, 9058314		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11681488, 15140063, 23409157, 24973447, 25225671, 25516468, 27575603, 29229565, 29429978, 30082321, 31900242, 32346380, 32880687, 34650558	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16717396, 1675200, 27917625, 30723474, 36766809	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21289206, 21368230, 26981545, 28056107	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16717396, 22064865, 29752628, 31332162, 36209084, 37082729, 39202464	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26246197, 30451213, 34330510, 34763485	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30652669	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10714554, 10907120, 11317661, 11821159, 15241679, 16216674, 16504056, 16907917, 17373930, 17659059, 19136037, 21368230, 21705657, 22150609, 23155466, 24462878, 25225671, 25831495, 26904692, 27151105, 27835062, 27920091, 28390953, 28673589, 28883439, 29067979, 29257900, 29367588, 29774468, 30074271, 30317603, 30723474, 30827273, 31053128, 31322069, 31525445, 31535398, 31560963, 7867888, 8968689, 9058314, 9699087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	21340626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	21340626		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15170498, 15935691, 16369773, 16677285, 17021921, 17143605, 18518884, 19324940, 19608431, 20857148, 21747906, 23213275, 25980762, 26064986, 28425463, 28582854, 28729691, 28783533, 29460080, 29514172, 30366352, 30852757, 30964746, 31014937, 31222113, 31525445, 31549627, 31704479, 7867888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	21340626		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	21340626		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28257518, 29844327		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	28736121	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22180355	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29684848, 30015512, 31023998		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26268591, 29584759, 36465606	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29584759		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36766809	Inhibit	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	16760259	Stimulate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	21078084	Associate	★☆☆☆☆ Found in Text Mining only
Diastematomyelia	Diastematomyelia	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19766516	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23487038, 26362649, 28870600, 29416618		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	27640094		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	LHGDN	16487026		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	16538446		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	28239811, 29555322		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28252221		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	11159171	Associate	★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	21146603		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disturbance in mood	Mood Disorder	PSYGENET_DG	21146603		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	1408461, 1824688, 22995210, 29137441		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	1825795, 31699819, 32572726, 33206953, 36401314	Associate	★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	23224615		★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28441413, 29068389, 29415888, 30423813		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36187125, 37026295	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	21203348	Associate	★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	16754651	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	31702083		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	9826379	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28199386, 30611204, 31012293		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	18946358	Stimulate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	22958187		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	24682681		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	35341013	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15149503, 15660915, 17596153, 21458658, 22000570, 22113474, 22151743, 22192168, 22445417, 22914497, 23454147, 23980846, 24008422, 24499290, 24996260, 26100037, 27543731, 27554821, 27639070, 28672978, 28990098, 29144049, 29353040, 29355930, 30223113, 30688372, 30729380, 30795812, 31036853, 31338033, 31515807, 7905045, 8040343, 8082304, 8082305, 9158100, 9199876, 9201310, 9933413		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	19122650	Associate	★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	35670482	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	33936110, 34675046	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	19479051	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22263663, 26692261, 30123051, 30128873, 31349155, 9400592		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23639073, 31678190	Associate	★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	20222111	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	18282668		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21623768	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	16219472		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28383326		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34424031, 35242299, 35262923, 39401154	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14506929, 15166131, 15212674, 20666952, 21477169, 29962266, 31821471		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15166131, 17582674		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17531990, 37081668	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	9176444, 9848307	Inhibit	★☆☆☆☆ Found in Text Mining only
ENDPLATE ACETYLCHOLINESTERASE DEFICIENCY (disorder)	Endplate acetylcholinesterase deficiency	BEFREE	7907636		★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	30232288		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	20011655	Inhibit	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	23472217	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21849676, 24655063, 28529118		★☆☆☆☆ Found in Text Mining only
Eosinophilia-Myalgia Syndrome	Eosinophilia	BEFREE	8230009		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	21281807		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21281807	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	33558373, 39884574	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	8728018		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	39259090	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27956120		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28125840		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23873689, 29069020		★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	10571738		★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	19062180	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	39907396	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18482209, 19733878, 21452064, 30951709		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19733878, 21452064, 30951709		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25144454	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32265897	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22013481, 28981100, 29855346, 34799871, 35463992, 36466860, 39307133	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29643275		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	29643275	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17525260		★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28039766		★☆☆☆☆ Found in Text Mining only
Eyelid Diseases	Eye Diseases	CTD_human_DG	17075842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fabry Disease	Fabry disease	Pubtator	39234251	Associate	★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency, acquired	Factor VIII deficiency	BEFREE	21788064		★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	23482605		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	37714974	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	27777774		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	11110692, 11342426, 11500375, 12423678, 15299030, 22234699, 2484652, 9242526		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	12750172		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12750172	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12750172	Stimulate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	11110692, 11342426, 11500375, 12423678, 15299030, 22234699, 9242526		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20447453, 22973830, 30929860, 35570777	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21619669, 9874656	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27342127, 29163491		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31795627	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22228550, 25534427		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	25611005, 29727742		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	27903846		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	30054161, 30145254, 30470640		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12748124, 28233863		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12389079, 15756299, 15996030, 17526009, 19344719, 24587093, 27853137, 28067328, 28304404, 28578937, 28656203, 30119204, 30467325, 30735937, 31508820		★☆☆☆☆ Found in Text Mining only
Fibrous skin tumor of tuberous sclerosis	Adenoma sebaceum	CTD_human_DG	16845661		★☆☆☆☆ Found in Text Mining only
Fibrous skin tumor of tuberous sclerosis	Adenoma sebaceum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	28040582		★☆☆☆☆ Found in Text Mining only
Frasier Syndrome	Fraser syndrome	Pubtator	17290408	Associate	★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	22447512		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	22447512		★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	30054161, 30145254, 30470640		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	29392310		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	27714757, 29054137		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37925508	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	12059049, 28683359		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	12121897, 34755133, 7698689	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27196487	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	9018762		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	34104107, 35905420	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30511397		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	18062835, 31385116		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	Pubtator	18062835	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19451644	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30714229		★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	31145102	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	GATA2 Deficiency	BEFREE	26049967, 27169477		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	27409423, 37250921	Inhibit	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	29317695	Inhibit	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	28043870		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	11840449, 15079760, 15570643, 15675129, 20412699, 26038090, 26698852, 28564617, 28968895, 29118757, 9844760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	19177264		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant cell arteritis	Pubtator	22147555, 26698852, 29731755, 36533991, 37703805, 40095634, 8669478	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gingival Hyperplasia	Gingival diseases	Pubtator	17328839	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	20958339		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	20958339	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	22355254, 32043817	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	25811482	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36254076	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22355254	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25811482	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29616680		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10349844, 1502171, 1653364, 16720059, 17415381, 17616812, 19646959, 20394835, 26155832, 27424145, 2847168, 3027177, 30975602, 31319548, 7832755, 8413882		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10349844, 1502171, 16947022, 18368485, 18594817, 1899864, 1974176, 20394835, 20493562, 22688424, 27409668, 2847168, 29532035, 32401608, 34566988, 34943886, 35814563, 36082628, 37158962, 37644431, 7531687, 7832755, 8253755	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17960384, 21636707, 39513882	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18368485		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10349844, 1502171, 1653364, 16720059, 17415381, 17616812, 19646959, 20394835, 26155832, 27424145, 2847168, 30049387, 3027177, 30975602, 31319548, 7832755, 8413882		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12386831, 12946268, 14966870, 15465602, 19944968, 26631910, 27157615, 27393295, 30049387, 30333036, 31152305		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	1282676, 20495288, 24859836, 25415278, 27829230, 31152305, 36052280, 39364412, 7506810, 7521890	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	8227070	Stimulate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28326160, 31279535		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11752021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	1825860		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	27225718	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18650480, 28391282, 7908616	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	33754492, 35172688, 40018947	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	33059348	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	29033931		★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	15979955, 30240467		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	27738386, 31941945	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10556195, 11520812, 16409297, 16809771, 20565368, 23089565, 25786571, 29142307, 30021835, 35015822, 7670118	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12239181, 14993881, 16131567, 20446793, 30142416, 35486633, 8609251	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11520812, 12239181, 12394168, 22982856, 23523972, 28665482, 28898706, 29691471, 7652763, 8136279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	12239181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	CTD_human_DG	22077062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10211889, 10951408		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	10211889, 12000723, 15708894, 21412229	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	10828042, 11435314, 12000723, 2176110, 23773925, 24722620, 2821069, 2839835, 30260027, 31681257, 35113934, 35500221, 9376602	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	1312372, 28982143, 9129047	Inhibit	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	10828042, 2176110		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	12107104, 16478776, 16717396, 16970687, 30956992, 35720300, 7902787	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	15068623, 16820703, 16970687, 17348243, 20960273, 23638863, 30132285, 30393005, 31182340, 31279175, 31399042, 8046301, 8408457, 9848715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19117935, 24924312, 35896115	Associate	★☆☆☆☆ Found in Text Mining only
Growth mental deficiency syndrome of Myhre	Myhre syndrome	Pubtator	33428109	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31379477		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	19757302, 2846090		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	21361912, 25171510, 28679952		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	18525195		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11101869, 16820703, 16970687, 19250279, 19797122, 20586818, 20696023, 20929277, 26634912, 29434699, 29877208, 31279175		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	16820703, 16970687, 19250279, 26634912, 32662826, 34418900, 34869781, 36243929, 8809144	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	16970687		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20696023	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	21623768, 23090124, 29877208, 32595646	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30484735		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23363816, 26676749	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	12133984, 29473686, 30559742, 34867992	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	15681825, 27733811	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29768622		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	20938210, 3091246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	21418620, 36420258	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	29437117, 31501486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20938210, 3091246		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	19040616	Stimulate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	31067191		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	21376199		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	12404285, 15286007, 37586321	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	15723658, 1902124, 34906138, 36669486, 38640253	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28234665		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	31464028, 31668371		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	12663233		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	16131564, 17379072	Associate	★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	29686681, 8854571		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	22176207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	34871302	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	24659122		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	26757951	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31170723		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	25501547, 31158952	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	27183637, 28257599, 28597951, 29358858, 37102762	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28119269	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	31191516	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	12970895, 1532590, 16718780, 19470388, 19625194, 21084489, 23395388, 24872585, 30602374, 33003293, 39736012, 9528902	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	22241125	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	32358389, 33506937	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	15996036, 23395388, 24520324, 32664850, 8706330	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26416327	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29666149	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	17916356	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	18336742	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	28780074	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	14690454, 16425360, 17634507, 21898483, 22792160	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24130824	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28838891	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	7657294		★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	26684629	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34196131	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	12710748		★☆☆☆☆ Found in Text Mining only
Heymann Nephritis	Heymann Nephritis	BEFREE	9848781		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	27819528, 28301691, 29222824, 29325465, 30140888		★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	20072626, 26320718		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	9355965		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10194423, 14959851, 22902395, 2554995, 28571489, 29456507		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12100149, 16982932, 18203952, 24008079, 34584203	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18077789		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	19059914		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22902395, 29456507		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33679692, 39923663	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	37674148	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28716226		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	CTD_human_DG	16112032		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Recessive	Hyper-Immunoglobulin E Syndrome	CTD_human_DG	16112032		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	25174587		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	11909970	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	19059914		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	8419187		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	10657822, 26162572		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18586252, 20145925, 23800176, 23884885		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18586252, 27294162, 33934108, 35163309	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31480861		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29874587		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	35748061, 9824577	Associate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	30520386		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	10571738, 1458689, 2523952, 8823363	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	9596698	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	19639725, 27764137, 34571865, 39837900	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	22287716	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25973747	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20040866, 24246020, 26064986, 30260038, 31042407, 31504461, 31805646		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	16970687		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	16970687	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	35154100	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29805094		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	24366614		★☆☆☆☆ Found in Text Mining only
Hypoplastic anemia	Hypoplastic anemia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	16754651	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	16820703, 29896255		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	16820703	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	7745958		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12173346, 18227840, 20653473, 30459756, 33123602, 36445478	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23213275, 31935962, 34999917	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24933425	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	23268291	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	29803800		★☆☆☆☆ Found in Text Mining only
Idiopathic aplastic anemia	Aplastic Anemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	17405833, 31403245		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26840075		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10398109, 10528036, 12914676, 16573560, 26709222, 28337871, 28559466, 28657784, 29727583, 31511015		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10515397, 12914676, 26709222, 33859634, 7664490	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31511015	Inhibit	★☆☆☆☆ Found in Text Mining only
IFN-gamma Receptor 1 Deficiency	IFN-Gamma Receptor 1 Deficiency	BEFREE	24509072		★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	11966768	Inhibit	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	12552499, 16493441, 24732061, 28391282, 30132546, 7908616, 8926288		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	12552499, 18249037		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Immune Complex Diseases	Immune Complex Diseases	CTD_human_DG	1825860		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	10811850, 23800860, 28170190, 30453935, 30746219, 31676671, 9486390		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	19451644, 21712187, 26549640, 34517836, 36669486	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	12176899, 17655693, 19077159, 22111667, 24231118, 24911453, 25707685, 26093269, 26703437, 27050808, 27554456, 28511637, 29333980, 29971001, 30808044, 30955035, 31651870, 31670229		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16497559, 16721359, 18275276, 23220634, 28570288, 29512397, 30194600, 30268380, 31429907, 7500020		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20811799, 23485736, 28582854, 29175260		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	LHGDN	12965263		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	23526099		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	21376199		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18828896, 26114934, 26586929, 34418900	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10207725, 18922720, 19079332, 20626296, 20848535, 21994045, 23042300, 24040033, 24367025, 24776844, 25171510, 25574094, 26072972, 27417569, 27492330, 28400196, 28954820, 29275447, 29275836, 29369775, 29416538, 29562270, 29718223, 29755013, 29901552, 29973876, 29991873, 30121880, 30134230, 30262728, 30333822, 30673986, 30825545, 31031628, 31417161, 31519285, 31566580, 8436398, 8642289, 8899099, 9870173		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10403730, 11101567, 12171960, 1446859, 15486347, 16760259, 1740279, 19128033, 19450149, 20629103, 20848535, 25171510, 26377844, 27824650, 28400196, 28797042, 28804910, 31417161, 32020185, 32661180, 33396621, 36437465, 37550393, 8680718	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11167992	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15020649, 32535589	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17347451		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21437440, 25172501, 26100037, 28672978, 29038621		★☆☆☆☆ Found in Text Mining only
Iniencephaly	Anencephaly	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33934108, 34763485	Associate	★☆☆☆☆ Found in Text Mining only
Interferon gamma receptor deficiency	Interferon Gamma Receptor Deficiency	BEFREE	11335769		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31086463		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32620160	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	39252217	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	20665551	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	20665551		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15654837, 19520737, 30097691	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	20626296, 30232288		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	25383957, 25695667		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	36825028	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	26198819, 26667180		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	26198819	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	32265897, 35812382	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	17170025	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22816602, 24667736, 26744473	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	23268291	Inhibit	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	25171510, 26744473, 27272011, 30040527		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29298609, 30588195		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	30588195	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	34273195	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	10765921, 11838858, 12858466, 15993233, 22740319, 24112428, 27040810		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	20064070		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis	Keratoconjunctivitis	BEFREE	21070541		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	29958030		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	8450029	Stimulate	★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	19136037		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21540239, 29100307, 30327172		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12192641, 19050297, 24030736	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20303284, 26101952		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	1942774, 20303284, 29868028		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	CTD_human_DG	3091246, 8289579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	15708894	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15708894, 28651949, 29868028	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21495874, 25147823, 28688148, 29261164, 30216653, 31369593, 31534532		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	1942774, 20303284, 29868028, 30231948, 31794765		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	28873085		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36215771	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	15935691		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	22355695, 27798858		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20938210, 3091246		★☆☆☆☆ Found in Text Mining only
Legionnaires` Disease	Legionnaires` Disease	CTD_human_DG	11349020		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	35103930, 35500221	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	15716079, 33793565, 8443970	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	35106507	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	10540222, 10564558, 15356162, 16339528, 20640364, 22683002, 23103228, 23449998, 23563829, 23936569, 27532668, 31600201, 33400985, 35462022	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	10564558, 11865434, 15056384, 20714752, 22392581, 22504648, 22527432, 22683002, 23103228, 24389160, 26431782, 28126361		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	28426172	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	11698444, 30642265	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	22144494, 2450707, 34168371	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10233902, 11195004, 19719389, 27015189, 28537657, 28604385, 28736298, 29475880, 30212785		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17115221, 28537657, 38640253	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21067287, 21240485, 21274000, 21310823, 23241893, 24183305, 25003726, 27907031, 28522576, 3140910, 32696549, 35967339, 37919606, 8471780	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	3140910	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	1511460	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10766757, 11279136	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11091213, 15657183, 16338495, 16612597, 17083564, 17115221, 1714325, 20814675, 22323453, 24903009, 25757160, 25795133, 25886742, 26081440, 26849076, 27748372, 30380364, 31373163, 31406210, 32456622, 32493790, 35297213, 35490594, 36563336, 36763100, 37993258, 7693036	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24757092	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	3086842	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	29474442		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10602416, 12423681, 15657183, 16338495, 23179394, 25092142, 27486989, 28604385, 30723581, 30747087, 30911134, 31142382, 31373163, 31406210, 9766506		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15871724, 16928387		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	17353346	Associate	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	32161179, 8270604	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	29150375		★☆☆☆☆ Found in Text Mining only
Leukomalacia Periventricular	Periventricular leukomalacia	Pubtator	15446581	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18279717, 30747087		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	35283023	Associate	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	22355695, 27798858		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28091876, 28253295		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	20331838, 28339344		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	31171504	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10374395, 10960440, 11315506, 11916626, 12531694, 15643599, 17390046, 17444857, 17711513, 19126646, 20602107, 21304407, 21334249, 22406869, 23632060, 23940564, 24101445, 24721706, 25169554, 25739411, 26163635, 26758620, 26893439, 26936017, 27279136, 27832318, 27840912, 28114424, 28237828, 28609212, 29033545, 29182438, 29316949, 29332347, 29387180, 29915022, 30007230, 30145359, 30264546, 30329167, 31021443, 31053499, 31391334, 31678303, 31710117, 31784083, 9126339		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12531694		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10491339, 10719024, 26163635, 27208430, 28387594, 30952766, 31170723, 8076766, 8773910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	11050046	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	14607968, 15661146, 34181338	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18582197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	31069827	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17158635, 19823170, 24375552, 33710617, 33815355, 8565296, 8706330	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	37759496, 38228248	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	8773910		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	29969462	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35485686	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	11474123	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21505270		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31846457, 36308662	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	12970895, 27284092, 36308662, 37926366	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	21703188, 26512422		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	20433827	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29915022, 30564277		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	31114575, 3122841		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10596703, 16753289, 16754651, 17878156, 19835594, 30971743, 31072323, 31379071, 36480571, 40247373	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	17023216, 26066058, 29843631, 30971743, 31072323		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24696530	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28169347, 29206475	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	19654941	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33298584	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	22207354	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	10398109, 21257923, 30367666		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17654453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18801189, 20804502, 21342183, 26719671, 27467256, 30833945, 31501431, 31625289, 32067413, 34408924, 34685495, 35836920, 36089762, 36688994, 38203736, 9353425	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24244422, 24894428, 26351076, 27447482	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	26348446, 29982425, 30914199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	28187172, 30953795	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	7614408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11528517, 17117487, 22406048, 28453771, 28841837, 29526761, 29671873, 9039167		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	36212172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	23771123	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10023862, 11226290, 12568118, 12746905, 15001474, 16563187, 18811944, 19050297, 19399944, 19404947, 19675166, 20334681, 20936133, 21067287, 21437440, 22028659, 24756936, 25989537, 26138472, 26582197, 26815287, 26916970, 27225718, 29475858, 29526761, 31090539, 31331400, 33010188, 33123584, 33329581, 33336388, 33549023, 33576004, 33763079, 33874983, 33882880, 36248893, 36732450, 36980810, 38233074, 38609158, 9276525	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11122256, 15542447, 18641361, 21370226, 24062776, 27814627, 29550813, 31040119, 31049024, 32868411, 33176801, 37204055, 39818255, 9010506	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24683191, 25225673, 27110576	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	30527631		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11115160, 11528517, 17117487, 22406048, 28118537, 28453771, 28841837		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10079289, 10403400, 11122256, 11226290, 11528517, 12047754, 12568118, 12746905, 16563187, 17049990, 17117487, 17469140, 17618444, 17713715, 19031096, 19121222, 19919944, 20954187, 21437440, 22057691, 22275109, 22406048, 22759859, 24443230, 24583068, 24644022, 24836587, 26094774, 26138472, 26703437, 26916970, 27255473, 28453771, 28628472, 28673589, 28755405, 28841837, 28848179, 29235391, 29409726, 29475858, 29499037, 29774490, 29848166, 29941705, 30174233, 31036046, 31090539, 31133860, 31200339, 31555283, 7526871, 9010506, 9276525, 9972961		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17117487, 17713715, 18641361		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12011374, 12568118, 12584053, 20167631, 22275109, 24482023, 28064541, 30207171, 31795780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	12568118, 18163476, 18795942, 19021013, 27738386, 31171837, 32396533, 37099456, 37204055, 37213666	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	15373921	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11528517, 17117487, 22406048, 28453771, 28841837		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	20883321, 24509072		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33160404	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	12930373, 32356861, 35510179, 35705524, 36401314	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	1954380, 31846457, 34461635	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	12930373, 27209435, 27559680, 28332776, 28516082, 28860338, 29686681, 30578871, 31015190, 31400073, 31537529, 31671661, 7819087, 8854571		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15161670, 15817683, 1846327, 18781564, 19359411, 21418178, 23529012, 26183766, 3120822, 32649887, 35572591, 37329186, 38640253	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15817683, 16201318, 1846327, 20207982, 21998209, 22479645, 24162786, 24655378, 26362649, 28195314, 29475880, 7691638		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16201318		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17823660	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35218354, 35432366	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	25733581, 27357153	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	8941669	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	29217528		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19066394		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	15175044, 18021470, 18245523, 20372104, 29794791, 9699721		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857, 19656130, 22105417, 24266973	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857, 1846327	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	15498860, 8941669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoproliferative Disorders	Lymphoproliferative Disorder	CTD_human_DG	22617429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	27296321, 28807602, 28960260, 29295842, 29686681, 30073799, 30671214, 31192813, 31400073		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27266510, 29132135	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27733811	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18077563, 23597432, 23608119, 28122130, 30306457, 30844329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23597432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	28428785		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19944968		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30484735		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15193440, 21357438		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10216096, 10651943, 15181474, 15735741, 15931634, 16219472, 16267208, 16721044, 18494001, 19580338, 21323572, 22095765, 22333315, 22624006, 22699677, 23053995, 23650543, 24164868, 24551119, 25051917, 25335731, 26397740, 26563945, 27050072, 27573075, 28388578, 28400477, 29054490, 29185091, 29478965, 29746817, 30018709, 30082828, 30336781, 30614229, 30657766, 31428522, 31666931, 7621246, 9038615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19446661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28383326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19733878, 21452064, 30951709		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1423266		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	16497559, 26758620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15095306, 15603851, 16418217, 17348819, 18497994, 20814891, 23152000, 23937717, 26300426, 26719671, 28731226, 28748356, 29408308, 29516506, 29666465, 29898990, 29946223, 30214604, 30297515, 30824332, 30953795, 31190880, 31362929, 31501431, 31787530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	7614408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28091876, 28253295		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11860540, 1457511, 17634541, 18559537, 18976739, 24141405, 30639700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15556691, 16896153, 22024742, 25725585, 26423423, 27435400, 29467893, 29970101, 30192158, 30782607, 31694582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10919667, 15477874, 17714738, 24607843, 24953652, 25967142, 28264911, 28317149, 30504123, 30877097, 6426791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20061762, 23460743, 24175851, 28558708, 29034543, 29050291, 29259270, 29306706, 29742685, 29849787, 30223387, 30537988, 30672717, 31113461		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	21626030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10197441, 11219496, 16094077, 19202079, 19489682, 25236570, 29435122, 30425515, 6426791, 8459207		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10766341, 11798180, 11848485, 15297404, 15817683, 16077989, 16219472, 16645618, 17195908, 17444857, 18093694, 18497994, 19059914, 20064070, 20084279, 20454519, 20814891, 21079151, 21127993, 21798758, 22182699, 22204817, 22323453, 22554587, 22798340, 22825336, 22906662, 23021240, 23053995, 23157679, 23341634, 23376950, 23685791, 23800860, 24671824, 24886620, 25270738, 25383957, 25449698, 25501829, 25695667, 25862816, 26386966, 26423423, 26885859, 26918940, 26965581, 27015189, 27312110, 27838900, 27903500, 27939375, 28091876, 28428785, 28488695, 28521284, 28552348, 28556960, 28569770, 28627973, 28677424, 28743486, 28839362, 28923396, 29066622, 29074605, 29103586, 29187357, 29190690, 29283429, 29290264, 29296519, 29470597, 29553967, 29712685, 29716923, 29762254, 29780381, 29896191, 30011369, 30039553, 30112109, 30115693, 30120107, 30188739, 30191398, 30262787, 30265974, 30388040, 30443842, 30552023, 30614229, 30674576, 30724158, 30747087, 30770367, 30814731, 30824332, 30919591, 31085700, 31242243, 31561328, 31603112, 31612217, 31646090, 31648379, 31827180, 7621246		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18337305, 19681846, 19959217, 25106529, 25208560, 25649976, 25921106, 28378632, 9159336		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10371355, 10608348, 16928387, 25735954, 28159747, 30122999, 30439686, 30770385, 30824815, 31348591, 31632588, 8474431		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	10866311		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	23429441	Inhibit	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	25052001, 27184921		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14993214, 15900487, 18572307		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15735741, 23053995, 26365188, 9038615		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19446661		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	29723656		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	22729559, 31788072		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16607283, 27463676		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	20433827	Stimulate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21327638	Associate	★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	24587999, 29953494, 31164242		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10382738, 10540230, 10691911, 11079619, 11839572, 12060397, 12672071, 12713589, 1347555, 1386286, 15009724, 15160996, 15944290, 16835788, 1701809, 17319941, 17342088, 17579625, 18511292, 19451644, 19501956, 20398276, 21216894, 2124247, 21248298, 21327637, 21389871, 22283601, 22767256, 22768350, 23335783, 23867552, 24200969, 24226422, 25765738, 25944800, 27003769, 28561041, 29150430, 29699605, 30326165, 30728070, 30953519, 31176707, 31506076, 31591149, 32002296, 32586358, 3283252, 32916126, 32939325, 33891607, 33914706, 34159752, 34220795, 34220837, 35563820, 36573964, 36920330, 37678920, 37730606, 37847239, 38195702, 6204001, 6413409, 7500024, 7740833, 7923247, 8101473, 8102061, 8869681, 9182821, 9652756, 9710216, 9740247	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	11028755, 11459172, 11839572, 12095976, 12394188, 12679797, 12684754, 1389476, 15009724, 16247014, 16835788, 17180681, 19089914, 20398276, 20960187, 21248298, 21327637, 22302285, 22815287, 23021240, 2506138, 25322862, 26039541, 26362649, 26632958, 27864228, 27883926, 28193627, 28561041, 28575659, 28666115, 28985469, 29383037, 29403003, 29915022, 29917141, 29977240, 30011369, 30021886, 30326165, 30425059, 30524902, 30836062, 30967646, 3104241, 31239444, 3135316, 31591149, 3918869, 7589065, 8062279, 8101762, 8242663, 8287600, 8640453, 8869681, 9241074, 9924695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15809206, 8242663	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	16224813, 28222797, 32231230, 8642353	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18322182, 18385764, 19089914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	9794839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32265897, 32495158, 32902917	Associate	★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	29617399		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	17622271, 29025273		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	23179933		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12084660, 20811799, 21161299, 27049572, 28161475, 29028592, 29543650, 31170723, 31284015, 31450770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24993299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	30844329, 31284015		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	12768194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	24838635, 9032125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	36901697	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	21540305	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22064865, 30862026	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29133519, 30862026, 32751810	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30383538	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20811799, 27720273, 30338401, 30383538, 30862026		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	10365660, 10419050, 11023194, 2112184, 3121738		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37766239	Stimulate	★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	17546485		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	LHGDN	17546485		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	31551696		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21481059, 22131390, 24188446, 24464956, 29017513		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23705001, 34867990	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33660144	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34867992, 35322867	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	22350281		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	16430971		★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	33336388	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	18276105	Inhibit	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	26313134		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	10571738, 17096152, 25928531, 8669478	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	11402621, 33952700	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	29168181	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729, 30704426, 34035116	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15270865	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18484687, 23298273, 27124053, 30704426		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	27124053, 3491174, 35222381, 36449533	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	25915602	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10192430, 16208410, 17201122, 1826658, 21744373, 24418325, 24913980, 27611810, 28702457, 28961609, 29510136, 29602156, 9763578		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12393684, 23232072, 25526031, 29515123, 29632307, 30376895, 38640253	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14717778, 15180863, 17201122, 17300840, 17363736, 20651070, 24489445, 27983725, 29089645, 30542346, 30872779, 31870332, 35563109, 36105747, 7949175, 8103718, 9207463, 9763578	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15287939, 17935669, 32565533	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17300840		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10193428, 10359806, 11422209, 16606644, 18261041, 25972006, 28336414, 9012830, 9771978	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10457887, 10505747, 10516776, 10809917, 11984595, 12020259, 12084660, 12458052, 12486605, 12940843, 14760959, 15182327, 15674394, 16430971, 16474427, 17250724, 17258784, 18256983, 18332247, 18573819, 19543959, 20228669, 20558237, 21067287, 22772450, 24176976, 24790215, 24913979, 25575858, 26223651, 26356194, 27023227, 27412504, 28094337, 28218775, 28236206, 28319253, 28336414, 28337205, 28757328, 29126030, 29209169, 29358315, 29773813, 30178232, 30374130, 30447707, 30472305, 30482463, 30668383, 30680474, 31054941, 31136008, 31292217, 31396345, 31494340, 31731047, 7509140, 7513071, 9225681, 9288735, 9345390, 9345450, 9357444, 9655468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	11673527, 21212154, 29295981	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	11984595, 12084660, 12486605, 18388249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	14558082, 16339578, 16754722, 17258784, 18769633, 19664140, 20065129, 21067287, 21622858, 25149293, 25690155, 27310932, 28218775, 29168181, 29518260, 29618802, 29692781, 30343897, 31024521, 33037101, 33463108, 34535569, 35648256, 9328251, 9808202	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	23517930		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	30770703	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	23517930		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25596452, 27611715, 29126030, 30404783		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	11147573	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	23133532	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29040534		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	30054161, 30145254, 30470640		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	18922720, 28317944, 29698503, 31478135		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10227809, 17509455, 18567864, 25889429, 25893403, 29405352, 29441481, 29718870, 7513071, 7836911, 8182116, 9335010		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	10227809, 25889429, 26347149, 26826242, 39346912	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	12865414	Inhibit	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	25893403, 33813453	Stimulate	★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	18245523, 24938282, 29794791, 8027577	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	32128597, 8941670	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16131564, 20472834, 23331180, 25608238, 31406210		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20472834, 21659535, 23236476, 24652987, 31406210	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25608238	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	21447007, 29307587		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20959405, 2119838, 23275297, 24819026, 27015189, 27793879, 28368400		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25637019		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	20814891, 25935866, 30651075		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11966768	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20938210, 3091246		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18056971		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26658659, 28165342, 30949687		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26658659, 28260995	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	24002640		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	10835688, 17897883, 24533969, 29236994, 29455951, 30035131, 30721928		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	LHGDN	19172849		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	19172849, 21422001, 38521068	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	32269142	Stimulate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11159171		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	17405833, 26057401, 29040534		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	17405833, 25098831, 26057401, 30886734, 36739295	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18420712, 21855683, 24594700, 30886734, 37731843	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21414848, 33172487	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27294162	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	38271857	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	25157497		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	31171504		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	25683265, 32669953	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	26123389		★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	31730293		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19639723, 21538928, 24947894, 26239551, 31870738, 33210729	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20924287, 26239551, 26358335, 30804419, 9088657		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11172294, 18312596, 19497133, 21573215, 21810020, 23272637, 26261644, 28207826		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	12536237	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19497133, 19948041, 25361008, 26261644, 32564263	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11278357	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	27575372	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	11479840		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10048768, 10091940, 10368655, 10419050, 10608348, 10733503, 10800095, 10849555, 10948322, 10960440, 11021590, 11172294, 11219496, 11358987, 11440620, 11802213, 11839572, 12140379, 12386831, 12394188, 12591988, 12684754, 12942126, 12946268, 12972432, 14502230, 14504825, 14511464, 14712313, 15009724, 15028475, 15147038, 15161670, 15661020, 15703492, 15735741, 15790789, 15811952, 16106073, 16267208, 16371631, 16522371, 16645618, 16721359, 17180681, 17518371, 17525260, 17634541, 18288212, 18422748, 18469857, 18497994, 18519033, 19059914, 19164174, 19202079, 1934072, 19497133, 19543243, 19596413, 19671000, 19944968, 20390427, 20602107, 20948440, 20948441, 20960187, 20980695, 2119252, 2119892, 21226554, 21244860, 21327637, 21357681, 21515097, 21573215, 21633700, 21642542, 21806674, 21810020, 21816905, 21880954, 21930732, 21971587, 22108090, 22146893, 22172723, 22204817, 22219594, 22293948, 22333315, 22354001, 22355695, 22382892, 22402444, 22405859, 22461641, 22554587, 22699677, 22729559, 22751779, 22760544, 22825336, 22872572, 22896667, 22906662, 22911133, 23042300, 23053995, 23187006, 23272637, 23333935, 23341634, 23355740, 23466552, 23486482, 23534449, 23671644, 23681283, 23715562, 23759675, 23800860, 23851682, 23898109, 23940564, 24040001, 24141405, 24174378, 24226422, 24300078, 24339898, 24357146, 24406503, 24489105, 24615277, 24645750, 24655378, 24830315, 24971369, 24982395, 25014220, 25111463, 25225903, 25403749, 25446402, 25449428, 25449698, 2549404, 25501829, 25515795, 25527357, 25625609, 25690042, 25695667, 25804437, 25822024, 25904754, 25921060, 25931171, 25933160, 25944800, 26025380, 26030772, 26039541, 26183926, 26238268, 26245994, 26303327, 26365188, 26372424, 26387951, 26423423, 26479470, 26526388, 26669617, 26695443, 26718030, 26758620, 26788922, 26824503, 27080226, 27157615, 27169467, 27233002, 27279136, 27295554, 27377534, 27430534, 27561689, 27627864, 27667683, 27699512, 27803044, 27833109, 27837027, 27837916, 27862183, 27883926, 27893434, 27899275, 27915371, 27935860, 27939375, 28002796, 28024448, 28061450, 28086772, 28091876, 28092804, 28114424, 28116088, 28159747, 28195314, 28229276, 28233863, 28314212, 28319047, 28336378, 28351891, 28404865, 28405527, 28418194, 28428785, 28445461, 28476753, 28488695, 28495792, 28504276, 28537894, 28552348, 28623086, 28638730, 28651122, 28666115, 28676342, 28710313, 28811967, 28829805, 28848066, 28858473, 28874690, 28886381, 28900509, 28918263, 28923858, 28963139, 28986561, 28987882, 29034543, 29050291, 29053415, 29090321, 29115604, 29140228, 29149434, 29190690, 29213216, 29222400, 29226090, 29268703, 29283429, 29296542, 29301958, 29306001, 29308319, 29317734, 29329948, 29332347, 29356862, 29360727, 29400948, 29402391, 29430789, 29434915, 29437535, 29459478, 29463593, 29469956, 29475880, 29516506, 29528990, 29553967, 29554212, 29570251, 29599512, 29632709, 29655565, 29661791, 29692616, 29699516, 29716923, 29752314, 29780381, 29795405, 29849787, 29917141, 29921905, 29967259, 29970684, 29985074, 30018042, 30030559, 30040142, 30050535, 30064894, 30073695, 30075815, 30090962, 30115693, 30131376, 30154083, 30221739, 30223387, 30231203, 30232146, 30262787, 30352261, 30377343, 30381467, 30406373, 30429378, 30457360, 30458232, 30504123, 30507311, 30518683, 30564277, 30630527, 30641083, 30662542, 30692995, 30713785, 30724158, 30736857, 30753225, 30778749, 30798159, 30837539, 30846174, 30859089, 30878596, 31009240, 31040155, 31043744, 31069134, 31085700, 31092734, 31092922, 31122259, 31152624, 31161832, 31171545, 31185212, 31211244, 31242938, 31243491, 31264492, 31269423, 31316010, 31377117, 31387637, 31398344, 31408414, 31410060, 31434495, 31451564, 31456687, 31511064, 31522446, 31522780, 31548293, 31554642, 31625289, 31657935, 31658961, 31680772, 31690181, 31708922, 31709529, 31720815, 31776206, 31783150, 31788072, 7577463, 7621246, 8137291, 8181865, 8228273, 8396466, 8459207, 8620527, 8656246, 8800741, 8826937, 8917716, 9167963, 9226179, 9335010, 9448920, 9457250, 9573023, 9578844, 9621132, 9649178		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29712687		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	17379072, 22525006, 26938944, 30132523		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	28963877	Inhibit	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	21426892	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	11032886	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15331418, 21549779		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	16131564	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	CTD_human_DG	17075842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurenteric Cyst	Neurenteric Cyst	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11668484, 12615731, 14586411, 14633699, 15065018, 15650242, 16522371, 16607283, 16721359, 21549779, 21626030, 21990352, 2509084, 28676342, 29296542, 29430789, 30326856, 7559588, 7622300, 9168934, 9439808, 9754962		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12107114, 12771917, 16886176, 16979248, 17032500, 17962944, 21626030, 21990352, 23719242, 2509084, 26452036, 30326856, 30629318, 31447858, 32514618, 33737337, 34016720, 35663470, 7559588, 8113394, 8144393, 8478984, 8482377, 8640845	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	28543773		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28543773, 33057020	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28528956, 29779267, 31098954		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	29473714	Inhibit	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	16607283		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	27448806	Associate	★☆☆☆☆ Found in Text Mining only
Neuroma, Acoustic, Bilateral	Bilateral vestibular Schwannoma	BEFREE	16721359		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	30524320		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18279717, 30747087		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	18279717		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	18279717	Stimulate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	21967766, 26244337, 31329326		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	21573215, 31847862		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	12866030		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25644696, 29975579, 30467325, 31480575		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10365094, 16542141, 19602462, 21507199, 23565296, 23851682, 26348446, 28092804, 28977839, 29147626, 29290264, 29383037, 29662549, 29716923, 29946223, 30429024, 31085700, 31090020, 31173242, 31253869, 31381177, 31732522		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	12794720		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30407606		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19289381, 19564875, 19633655, 21536945, 25011057, 26064986, 28235154, 28673589, 29445415, 29560551, 29874587, 30115554, 31450770, 31736971		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19564875, 28454543, 29133519, 29560551, 33934108, 35219585	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26246197, 33094626, 33809270, 34283808, 34330510, 35784287	Stimulate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30382535		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	22287716	Associate	★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	24112428		★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	8419187		★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	7507500, 9443483		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Inhibit	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	14872492, 22380539, 24690414, 25807424, 28112376, 38157375	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33362761	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	12351400	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	11335768, 24509072, 31746120, 31771516		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	23083630, 39849463	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19059914, 25326857, 27908965, 31822927		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	28942122, 28982143, 29886069		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	28982143	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteopetrosis Autosomal Dominant Type 2	Osteopetrosis	BEFREE	30889272		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22380539		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22380539, 23133532, 25384921, 29745905, 35791093, 36077598, 39329776	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	1473155, 2121483, 32388585	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15390286, 2122912, 31040694		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37993664	Stimulate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	27633913		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	24434259		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11860540		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33231569	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11860540, 1457511, 17634541, 18559537, 18976739, 24141405, 30639700		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18276105		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10376977, 11118442, 12438449, 1502188, 17349014, 19752753, 22083345, 28327095, 29242379, 30135206, 31064389, 33203236, 33921111, 34181334, 34626802, 34697060, 35507102, 35820543, 36751636, 37151134, 38007483, 7798293, 8270604, 8598323, 9374379	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27458100	Stimulate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	26245994, 29332347, 30322390		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15556691, 16896153, 22012231, 22024742, 23029049, 23401468, 25725585, 26423423, 27435400, 29467893, 29970101, 30192158, 30782607, 31694582		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30782607		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28405527		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11454803, 19476837, 21321110, 22537161, 26423423, 27777771, 31548328, 32051287, 36494785, 8093857	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25274283	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	15316224, 25120736		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15316224		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11310825	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16127431, 30680957	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19152246, 25839229, 28854965		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	12423678, 23523972, 25174587, 25383872, 27634200		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19755523		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	22322668		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	22322668	Inhibit	★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	31572394	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	35977513	Inhibit	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	20821074, 27819519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	20821074		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	11468172, 17409595, 18509087, 19740339, 19997502, 21208912, 22335964, 24960164, 28376092, 31340370, 31402625	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	31101076, 8785452	Stimulate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	28504089, 29483289		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	10212304, 19480659	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15648059, 21472005, 23485736, 24948069, 28821274, 30954070, 31248424		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17376993, 18678243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18197754, 27230441, 33057020, 37686360, 38231411	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	15194531, 16131564, 17379072, 22172098		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10211889, 10951408		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28384257, 29944680		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	11710918, 29335495, 35140724	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	12366695		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	18373702	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	28815581	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	28761292, 28815581		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	12121897	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	23460743		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	29898177	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29607157		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16677285, 18230112, 20655098, 20958339, 25832120, 29966238		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	22995210, 25832120, 30890897	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11144404, 11858158, 16677285, 18230112, 20655098, 20932510, 20958339, 22995210, 28640144, 28736819, 28993635, 8608641		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	11953387, 16542362, 20958339, 23046796, 25832120, 27602578, 28736819, 30890897, 34381457	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34502071	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39221259	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31613907		★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	29615965		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	19608431, 26431782		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	19608431, 26431782		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29100307		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31728886		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	25079795		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	35977513	Inhibit	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	23213275, 26321864, 28125840, 28271611		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36631635	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	CTD_human_DG	21357438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleurisy	Pleuritis	BEFREE	20880396		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28051885, 30580448, 30988342		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30988342, 31115532, 32393090, 33094626	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	22965887, 24463275	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	24820309		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	28769929		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	17405833, 19364061, 19953283	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19953283		★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	22776106		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26589234, 29202383, 31352811		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20110422		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20943267, 23075808, 30212785, 30443842		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16611416, 31402942		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31414991		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16128947, 16243485, 17518371, 29445068, 30119881, 31803181, 8076766, 8706330, 9096578		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	29502462, 30984189		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21447007, 29307587		★☆☆☆☆ Found in Text Mining only
Primary Peritonitis	Peritonitis	CTD_human_DG	19804847		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30119881, 31173810		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	29312328		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30390673		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	23213275, 28271611		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31659187		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10705309, 10919667, 15477874, 17714738, 24607843, 24953652, 25967142, 28264911, 28317149, 30504123, 30877097, 6426791		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	10705309, 12920242	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10705309, 18211896, 25351720, 28317149, 29896191, 30488530, 33569050, 37067635, 37223924	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15477874		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15800938, 17719815		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25967142	Inhibit	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	28963877	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	26245994, 29332347, 30322390		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	16150856, 21377504, 25317700, 26148246, 26339796, 28862188		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	15186319		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10698972, 11310827, 11438456, 14675183, 15608502, 16441627, 17852079, 20555352, 21614010, 23376980, 24008422, 24509958, 27184185, 27554821, 28461105, 28494466, 28554321, 28696418, 28931765, 29062018, 29269725, 29859926, 29979898, 30268387, 31062065, 31509228, 7528246, 7531641, 9856816		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	14675183, 18981165	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18200047, 21085185, 22277938, 24008422, 28042206, 28239238, 29062018, 31509228, 35297512, 36288286, 36988247, 37314119, 7923918, 8027577, 8823363	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18245523, 21614010, 24518112, 35784287, 35848967	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	15560761, 17852079		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20811799, 30407606		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	24044676		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11390417, 17878156, 17996064, 20427767, 22183488, 22417244, 23731729, 24805101, 26403459, 26517304, 27769261, 32089881, 32160903, 34675046, 37307368	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19220836, 19229703, 20529083, 22352763, 28934595, 35553638	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19279357, 30349227, 33868270	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11104801, 23793505, 24805101, 30952808, 31060902, 31112138		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11092205, 2258640, 28739343, 30943978, 31511015		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	2540218, 30943978, 9949171	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	18339897		★☆☆☆☆ Found in Text Mining only
Pyogenic arthritis pyoderma gangrenosum and acne	Pyogenic arthritis-pyoderma gangrenosum-acne syndrome	Pubtator	34492165	Associate	★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	23639073		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30448924		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	28776757		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	1462123		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	29771971		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	10048768, 1423266		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10048768, 10537342, 10849555, 12930377, 14602239, 1606987, 22132887, 25109451, 26253654, 7490887		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	29771971		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	29771971		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25466892, 28714020		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	3091246, 8289579		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30943978		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29684352, 30337650, 31013737		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	15999001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory Tract Diseases	CTD_human_DG	21937650		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	23181789, 23806637, 28230530, 30943978	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27793801	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	32542038, 33371882	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	24626309	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27758017, 29677366, 31704479		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	3123268		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15133451	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23041127		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29948178		★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	21989738	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	2510384, 25287131, 27966453		★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	40226625	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	15509528	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	29236994, 29332266		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10606983, 10931160, 11022930, 11037979, 11055825, 11219392, 11463416, 11508579, 11755617, 11824970, 12375327, 12571841, 12632414, 1347492, 1378495, 14558082, 1462123, 15004722, 15248214, 15290728, 15361391, 15535835, 16292516, 16846535, 16947381, 17100759, 17824960, 1909216, 1915559, 20542964, 20615213, 2113447, 21905879, 21952924, 22258456, 23077565, 24078927, 24574215, 24690414, 24907345, 25708927, 26302971, 26440629, 26521731, 27190305, 27484962, 28117352, 28295853, 28436448, 28662934, 28673589, 28866647, 28912850, 29066221, 29166574, 29752727, 29903026, 30008722, 30092847, 30167920, 30402903, 30718650, 31197255, 31312989, 31494241, 8163935, 8318038, 8608632, 8778953, 8961900, 9255106, 9433869, 9525978, 9717978		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	14558082, 18843763		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22450443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	Pubtator	10211889, 26577568	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20074473	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33224143	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35064698, 35274773	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	16189158	Inhibit	★☆☆☆☆ Found in Text Mining only
Ruptured Appendicitis	Appendicitis	CTD_human_DG	16367942		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	25111463		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10398109, 11580222, 12366781, 16053025, 17937104, 18976443, 20722470, 21540308, 26579569, 27460362, 28114394, 28590292, 29275836, 29449421, 31783271, 7774049, 9032124, 9311498		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	10573228, 11817671, 18654018, 20659127, 21540308, 22984568, 24199653, 24768588, 27929051, 29449421, 31783271, 32701935, 32774332, 34399367, 7774049	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11091281, 12746045, 15303638, 24882950, 27460362, 9311498	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	15019280, 17937104, 18051824		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21177920, 23073617	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	11390417, 21540308	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	9311498	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29896199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	33717062, 39778225	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	36005179	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	CTD_human_DG	9794839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	34440851	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37993664	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	9201246	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	31171504, 32269142	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	CTD_human_DG	9794839		★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	CTD_human_DG	9794839		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	20132993, 22623148, 23083632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20132993, 29032575, 35719348	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	21255481, 22623148, 23083632, 27563937, 27810494, 27819519, 28011441, 28974776, 29032575, 29803226, 30051373, 31053623, 9075278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23083632, 27169466, 32875100, 37301236	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29803226	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	2258640, 3122841, 31552041, 7636301		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	7826142	Inhibit	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37028702, 37471168	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10366109, 11710721, 19536281, 26057401, 37310903, 7636301, 7826142	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Peritonitis	Peritonitis	CTD_human_DG	19804847		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23639073, 28843235	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	37242266	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	22187279, 34790197	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	24475220, 32996896, 34461635, 34566996, 35090402	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	33705988	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	12219025, 21711552, 23874546, 24475220, 28222313, 28287491, 28439500, 28601305, 28974543, 28975969, 29064085, 29470918, 29562764, 29610934, 29664837, 29733298, 30547887, 31201735, 31545153, 31690258		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	9806674		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	16129616		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	16672072, 17052299, 24077366		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	20934357, 29773597, 31141802		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	12384415		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	7964459, 8704236	Associate	★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	16677285		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	11464181, 11594572		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	9649208	Associate	★☆☆☆☆ Found in Text Mining only
Shagreen patch	Shagreen patch	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	29748772		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	26904697, 29465367		★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	28836691		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11302869, 12384933, 1343766, 15692983, 16166103, 16507175, 17075845, 22018243, 23045702, 26183766, 31335688, 33179091, 34045583, 34594326, 35218354, 36248893, 36505431, 37239341, 7578884, 9867125	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12067313, 2444171, 25346207, 26904697, 31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27461134	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21437440, 22673732, 22992805, 23771123, 24008422, 36672844, 37471168	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11121150, 11380148, 12142611, 22385240, 23454147, 24008422, 26100037, 27348082, 27939414, 28459659, 29155016, 29977237, 30021889, 30688372, 31064750, 8040343, 9767281		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21969559, 24464587		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31872261	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28830779, 29744684		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	29168015		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10365094, 18093694, 29020964, 31381177, 8880099, 9415308		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12107114, 1711927, 17143611, 2846175, 29020964, 3018738, 34228218, 36879122, 8880099	Associate	★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	23324130		★☆☆☆☆ Found in Text Mining only
Smoldering Systemic Mastocytosis	Smoldering Systemic Mastocytosis	BEFREE	21708453		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	19059914		★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	23121407		★☆☆☆☆ Found in Text Mining only
Spinal Cord Myelodysplasia	Spinal Cord Myelodysplasia	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12375327, 22269151, 28390966		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	11114280, 12759295, 18512784, 28843049	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	20687202	Inhibit	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	23607629	Stimulate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15900487		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10368655, 10408389, 11710944, 21474117, 22402444, 28403126, 28526810, 28791392, 29458011, 29967556, 30017387, 3150646, 9039974		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12700631		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17195908, 21258967, 21452064		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17096152, 18547033, 19596857, 21207025, 25483651, 25591548, 30192802, 30320380, 30407504, 30722122, 30828910, 31422205, 31624067, 31970439, 32319563, 34111704, 34729919, 35267186, 35363406, 36361609, 36515567, 37185662	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19480853, 21442435, 28053372	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28977839, 30253973		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21409596, 29228662, 29328389, 29355614, 30192802		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	15946179		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	25591771, 30631648, 31326419		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25980762, 27342127, 29163491		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20061762, 23460743, 24175851, 28558708, 29034543, 29050291, 29259270, 29306706, 29742685, 29849787, 30223387, 30526523, 30537988, 30672717, 31113461		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20646001, 34104107	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	23067142		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1331059, 14632759, 17717429, 20507321, 21070385, 22325465, 24175851, 25270738, 25432406, 26934444, 27147580, 29034543, 29259270, 29349089, 30223387, 31113461, 31260655, 31930120, 32265897, 33312758, 33678158, 34159686, 36401393, 37056782, 7913795, 9769120	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20061762	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23243425	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21805152	Stimulate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	21376199		★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28777458, 30047620, 8639773		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	31632104		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	31171504		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	15361391, 22121133, 8608632		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	30550623, 9358757	Associate	★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	31760574		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	22740319, 27296321, 31676671		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10366109, 1718289, 18576303, 21535076, 2258640, 23359533, 24289089, 25880423, 26057401, 28384257, 28502678, 29348297, 29944680, 31162840, 3122841, 31552041, 7636301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	28736298		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11453809, 29100307		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28968895		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10197441		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	35341013	Associate	★☆☆☆☆ Found in Text Mining only
Tethered Cord Syndrome	Primary Tethered cord syndrome	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	12713785	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24463275	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24820309		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	28511637	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia 1	Thrombocytopenia	Pubtator	25253772	Associate	★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	15815632		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	22965887	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	24820309		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29981156		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	29981156	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29981156	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	10403908, 10886240, 17509455, 2137461, 26749212		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	11158064, 12608932, 1906894, 28656526, 29256181, 30132285, 31399042		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	18030468	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21503841, 31159823, 32348468	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	16970687	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	26703437, 31279175		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20586818, 27555670, 29877208	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	1735190, 1899065, 19250279, 20586818, 32604892, 36032148, 36248893	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34868029, 36362417	Stimulate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	22509092, 22992806, 23224615		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	28483238		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	10197441, 22906662		★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	15789056		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	26987263, 8854571		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	22350281		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	31798578		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21361912, 29933930, 32971948, 33495298, 34465315, 35377948, 37720228, 37981615, 40482645	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29330447, 31479522		★☆☆☆☆ Found in Text Mining only
Tsc2 Angiomyolipomas, Renal, Modifier Of	Modifier Of Renal Tsc2 Angiomyolipomas	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tuberous Sclerosis	Tuberous Sclerosis	CTD_human_DG	16845661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	36758851	Inhibit	★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	36094518	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10207725, 12876555, 15827446, 19203362, 20626296, 20848535, 21091928, 21818367, 21945121, 21994045, 23446770, 24776844, 25171510, 26072972, 26698117, 27492330, 27622899, 28139755, 29773813, 30134230, 30159037, 30214011, 30763538, 30797423, 31002701, 31077582, 31206576, 31383741, 31563276, 8436398		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15628695		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	10928100		★☆☆☆☆ Found in Text Mining only
Unilateral agenesis of kidney	Renal aplasia	BEFREE	29656904		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18077563, 23597432, 30844329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23597432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	1353063, 15297736, 27999236, 29478100, 29752880, 36040901, 36567803, 39986350, 40777041, 8093683	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	18548239		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19079205, 25885042	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19089920, 23521696	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20084279, 39684873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10521926, 11278357, 17615234, 18288269, 18337305, 23587428, 25141788, 25208560, 25921106, 27721577, 28378632, 28526810, 33017516, 33390854	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22094905	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21872231, 26586929	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	17870068, 18296654, 22429778, 31025552, 33136179, 7488605	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28448663, 30639792		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	10469047, 15196263, 27478014, 32899567	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	LHGDN	18579762		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	20482398, 21334264, 22269151, 23960020, 29068389, 9856775		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	32479651, 35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	14977779	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	16024856	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	3145163	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	18199975		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	LHGDN	18199975		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	20591073	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	33384687	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29266409, 30803759		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12972116, 28148598		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	2492403, 33196557, 34893640	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	39578766	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	BEFREE	20064070		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	15079760, 15675129, 26703437, 30080295, 30194600, 30249047		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	23650522, 2492403	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34950150	Stimulate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	24168677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	10926204, 31100416		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	LHGDN	12401479		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	27110576	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31260744		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	16224813	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	BEFREE	18820938, 25721262, 27191524, 28273427, 29199612, 30404783, 31046170, 31172649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	23777204, 24681574, 25721262, 31097717, 32188902, 32705792, 33200798, 34081788, 35464413, 9077486	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18820938, 25721262, 27191524, 28273427, 29199612, 30404783, 31046170, 31172649		★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar lichen sclerosus	Pubtator	22113482, 37317627	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30104397	Associate	★☆☆☆☆ Found in Text Mining only
Wernicke Encephalopathy	Wernicke Encephalopathy	BEFREE	30564961		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Whipple Disease	Whipple disease	Pubtator	34093562	Stimulate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34519584	Inhibit	★☆☆☆☆ Found in Text Mining only
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	22192885, 22677194		★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	14726378, 1846327, 2539385		★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	CTD_human_DG	22617429		★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	30296293		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	11710926	Stimulate	★☆☆☆☆ Found in Text Mining only