Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	150084
Gene name	Immunoglobulin superfamily member 5
Gene symbol	IGSF5
Synonyms (NCBI Gene)	GSF5JAM4
Chromosome	21
Chromosome location	21q22.2

43 Show/Hide all (43)

miRTarBase ID	miRNA	Experiments
MIRT1062766	hsa-miR-1297	CLIP-seq
MIRT1062767	hsa-miR-2052	CLIP-seq
MIRT1062768	hsa-miR-2110	CLIP-seq
MIRT1062769	hsa-miR-219-2-3p	CLIP-seq
MIRT1062770	hsa-miR-26a	CLIP-seq
MIRT1062771	hsa-miR-26b	CLIP-seq
MIRT1062772	hsa-miR-2964a-3p	CLIP-seq
MIRT1062773	hsa-miR-302a	CLIP-seq
MIRT1062774	hsa-miR-302b	CLIP-seq
MIRT1062775	hsa-miR-302c	CLIP-seq
MIRT1062776	hsa-miR-302d	CLIP-seq
MIRT1062777	hsa-miR-302e	CLIP-seq
MIRT1062778	hsa-miR-3150a-3p	CLIP-seq
MIRT1062779	hsa-miR-3157-5p	CLIP-seq
MIRT1062780	hsa-miR-3676	CLIP-seq
MIRT1062781	hsa-miR-372	CLIP-seq
MIRT1062782	hsa-miR-373	CLIP-seq
MIRT1062783	hsa-miR-4271	CLIP-seq
MIRT1062784	hsa-miR-4277	CLIP-seq
MIRT1062785	hsa-miR-4452	CLIP-seq
MIRT1062786	hsa-miR-4453	CLIP-seq
MIRT1062787	hsa-miR-4465	CLIP-seq
MIRT1062788	hsa-miR-4480	CLIP-seq
MIRT1062789	hsa-miR-4502	CLIP-seq
MIRT1062790	hsa-miR-4538	CLIP-seq
MIRT1062791	hsa-miR-4633-3p	CLIP-seq
MIRT1062792	hsa-miR-4643	CLIP-seq
MIRT1062793	hsa-miR-466	CLIP-seq
MIRT1062794	hsa-miR-4691-3p	CLIP-seq
MIRT1062795	hsa-miR-4694-5p	CLIP-seq
MIRT1062796	hsa-miR-4725-3p	CLIP-seq
MIRT1062797	hsa-miR-4747-5p	CLIP-seq
MIRT1062798	hsa-miR-4762-3p	CLIP-seq
MIRT1062799	hsa-miR-4789-3p	CLIP-seq
MIRT1062800	hsa-miR-520a-3p	CLIP-seq
MIRT1062801	hsa-miR-520b	CLIP-seq
MIRT1062802	hsa-miR-520c-3p	CLIP-seq
MIRT1062803	hsa-miR-520d-3p	CLIP-seq
MIRT1062804	hsa-miR-520e	CLIP-seq
MIRT1062805	hsa-miR-548an	CLIP-seq
MIRT2014810	hsa-miR-365	CLIP-seq
MIRT2014811	hsa-miR-4641	CLIP-seq
MIRT2247116	hsa-miR-490-5p	CLIP-seq

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0098609	Process	Cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
610638	5952	ENSG00000183067

Q9NSI5

Protein name

Immunoglobulin superfamily member 5 (IgSF5) (Junctional adhesion molecule 4) (JAM-4)

Protein function

Provides, together with MAGI1, an adhesion machinery at tight junctions, which may regulate the permeability of kidney glomerulus and small intestinal epithelial cells. Mediates calcium-independent homophilic cell adhesion. In testis, it may fun

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	39 → 140	Immunoglobulin I-set domain	Domain

Sequence

MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV

Sequence length

407

Interactions

View interactions

KEGG Pathway
Tight junction
Epithelial cell signaling in Helicobacter pylori infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
ASTHMA	—	GWAS catalog	32296059	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	37851288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37851288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	29422769	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	21347282	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17013881	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	Pubtator	35524249	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35524249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33506058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IGSF5 (immunoglobulin superfamily member 5)

Bookmark This Gene