Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	56832
Gene name	Interferon kappa
Gene symbol	IFNK
Synonyms (NCBI Gene)	IFNT1INFE1
Chromosome	9
Chromosome location	9p21.2
Summary	This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on

20 Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT447455	hsa-miR-1539	PAR-CLIP	22100165
MIRT447454	hsa-miR-191-3p	PAR-CLIP	22100165
MIRT447453	hsa-miR-4635	PAR-CLIP	22100165
MIRT447452	hsa-miR-6505-5p	PAR-CLIP	22100165
MIRT447455	hsa-miR-1539	PAR-CLIP	22100165
MIRT447454	hsa-miR-191-3p	PAR-CLIP	22100165
MIRT447453	hsa-miR-4635	PAR-CLIP	22100165
MIRT447452	hsa-miR-6505-5p	PAR-CLIP	22100165
MIRT447455	hsa-miR-1539	PAR-CLIP	22100165
MIRT447454	hsa-miR-191-3p	PAR-CLIP	22100165
MIRT447453	hsa-miR-4635	PAR-CLIP	22100165
MIRT447452	hsa-miR-6505-5p	PAR-CLIP	22100165
MIRT447455	hsa-miR-1539	PAR-CLIP	22100165
MIRT447454	hsa-miR-191-3p	PAR-CLIP	22100165
MIRT447453	hsa-miR-4635	PAR-CLIP	22100165
MIRT447452	hsa-miR-6505-5p	PAR-CLIP	22100165
MIRT1060904	hsa-miR-4432	CLIP-seq
MIRT1060905	hsa-miR-487a	CLIP-seq
MIRT1060906	hsa-miR-499-5p	CLIP-seq
MIRT1060907	hsa-miR-9	CLIP-seq

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005132	Function	Type I interferon receptor binding	IDA	11514542
GO:0005576	Component	Extracellular region	IC	11514542
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	11514542
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	11514542
GO:0009615	Process	Response to virus	IEP	11514542
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	11514542
GO:0030101	Process	Natural killer cell activation	NAS	11514542
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0045089	Process	Positive regulation of innate immune response	TAS	11514542
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

MIM	HGNC	e!Ensembl
615326	21714	ENSG00000147896

Q9P0W0

Protein name

Interferon kappa (IFN-kappa)

Protein function

May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to dire

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	33 → 204	Interferon alpha/beta domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in keratinocytes, monocytes and in resting dendritic cells. {ECO:0000269|PubMed:11514542, ECO:0000269|PubMed:12391192}.

Sequence

MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECL
RENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQ
QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK

Sequence length

207

Interactions

View interactions

KEGG Pathway
Cytokine-cytokine receptor interaction
RIG-I-like receptor signaling pathway
JAK-STAT signaling pathway

IFNK (interferon kappa)

Save This Analysis