Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	338376
Gene name	Interferon epsilon
Gene symbol	IFNE
Synonyms (NCBI Gene)	IFN-EIFNE1IFNT1INFE1PRO655
Chromosome	9
Chromosome location	9p21.3

31 Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025898	hsa-miR-7-5p	Microarray	19073608
MIRT638568	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT638567	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT638566	hsa-miR-764	HITS-CLIP	23824327
MIRT638565	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT638564	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT497132	hsa-miR-6502-3p	PAR-CLIP	22291592
MIRT497131	hsa-miR-3919	PAR-CLIP	22291592
MIRT497130	hsa-miR-4756-3p	PAR-CLIP	22291592
MIRT497129	hsa-miR-4786-5p	PAR-CLIP	22291592
MIRT497128	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT497127	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT497126	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT497125	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT497124	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT497123	hsa-miR-5585-3p	PAR-CLIP	22291592
MIRT638568	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT638567	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT638566	hsa-miR-764	HITS-CLIP	23824327
MIRT638565	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT638564	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT497132	hsa-miR-6502-3p	PAR-CLIP	22291592
MIRT497131	hsa-miR-3919	PAR-CLIP	22291592
MIRT497130	hsa-miR-4756-3p	PAR-CLIP	22291592
MIRT497129	hsa-miR-4786-5p	PAR-CLIP	22291592
MIRT497128	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT497127	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT497126	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT497125	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT497124	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT497123	hsa-miR-5585-3p	PAR-CLIP	22291592

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	ISS
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

MIM	HGNC	e!Ensembl
615223	18163	ENSG00000184995

Q86WN2

Protein name

Interferon epsilon (IFN-epsilon) (Interferon epsilon-1)

Protein function

Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infecti

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	27 → 186	Interferon alpha/beta domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Endometrium-specific. {ECO:0000269|PubMed:23449591}.

Sequence

MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVF
SLTEKLSKQGRPLNDMKQELTTEFRSPR

Sequence length

208

Interactions

View interactions

KEGG Pathway
Cytokine-cytokine receptor interaction
RIG-I-like receptor signaling pathway
JAK-STAT signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IFNE-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (10)
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27270441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31490936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27270441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34573430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18362232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31490936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27270441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27270441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	23802172		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	23802172		★★★★★ ★☆☆☆☆ Found in Text Mining only

IFNE (interferon epsilon)

Bookmark This Gene