Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3386
Gene name	Intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Gene symbol	ICAM4
Synonyms (NCBI Gene)	CD242LW
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-ty

SNP ID	Visualize variation	Clinical significance	Consequence
rs77493670	A>G	Affects	Coding sequence variant, missense variant

93 Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048899	hsa-miR-93-5p	CLASH	23622248
MIRT1058579	hsa-miR-1270	CLIP-seq
MIRT1058580	hsa-miR-1343	CLIP-seq
MIRT1058581	hsa-miR-1976	CLIP-seq
MIRT1058582	hsa-miR-3194-3p	CLIP-seq
MIRT1058583	hsa-miR-361-3p	CLIP-seq
MIRT1058584	hsa-miR-3649	CLIP-seq
MIRT1058585	hsa-miR-378g	CLIP-seq
MIRT1058586	hsa-miR-4279	CLIP-seq
MIRT1058587	hsa-miR-4437	CLIP-seq
MIRT1058588	hsa-miR-4531	CLIP-seq
MIRT1058589	hsa-miR-4532	CLIP-seq
MIRT1058590	hsa-miR-4674	CLIP-seq
MIRT1058591	hsa-miR-4722-3p	CLIP-seq
MIRT1058592	hsa-miR-512-5p	CLIP-seq
MIRT1058593	hsa-miR-620	CLIP-seq
MIRT2013551	hsa-miR-122	CLIP-seq
MIRT2013552	hsa-miR-1234	CLIP-seq
MIRT1058580	hsa-miR-1343	CLIP-seq
MIRT1058581	hsa-miR-1976	CLIP-seq
MIRT2013553	hsa-miR-3135b	CLIP-seq
MIRT1058582	hsa-miR-3194-3p	CLIP-seq
MIRT1058583	hsa-miR-361-3p	CLIP-seq
MIRT2013554	hsa-miR-3652	CLIP-seq
MIRT1058585	hsa-miR-378g	CLIP-seq
MIRT2013555	hsa-miR-3922-5p	CLIP-seq
MIRT1058586	hsa-miR-4279	CLIP-seq
MIRT2013556	hsa-miR-4430	CLIP-seq
MIRT1058587	hsa-miR-4437	CLIP-seq
MIRT1058590	hsa-miR-4674	CLIP-seq
MIRT1058591	hsa-miR-4722-3p	CLIP-seq
MIRT2013557	hsa-miR-564	CLIP-seq
MIRT2245678	hsa-miR-106a	CLIP-seq
MIRT2245679	hsa-miR-106b	CLIP-seq
MIRT2013551	hsa-miR-122	CLIP-seq
MIRT2013552	hsa-miR-1234	CLIP-seq
MIRT1058580	hsa-miR-1343	CLIP-seq
MIRT2245680	hsa-miR-140-3p	CLIP-seq
MIRT2245681	hsa-miR-150	CLIP-seq
MIRT2245682	hsa-miR-17	CLIP-seq
MIRT1058581	hsa-miR-1976	CLIP-seq
MIRT2245683	hsa-miR-20a	CLIP-seq
MIRT2245684	hsa-miR-20b	CLIP-seq
MIRT2245685	hsa-miR-302a	CLIP-seq
MIRT2245686	hsa-miR-302b	CLIP-seq
MIRT2245687	hsa-miR-302c	CLIP-seq
MIRT2245688	hsa-miR-302d	CLIP-seq
MIRT2245689	hsa-miR-302e	CLIP-seq
MIRT2013553	hsa-miR-3135b	CLIP-seq
MIRT2245690	hsa-miR-3150a-5p	CLIP-seq
MIRT2245691	hsa-miR-3150b-5p	CLIP-seq
MIRT1058583	hsa-miR-361-3p	CLIP-seq
MIRT1058584	hsa-miR-3649	CLIP-seq
MIRT2013554	hsa-miR-3652	CLIP-seq
MIRT2245692	hsa-miR-372	CLIP-seq
MIRT2245693	hsa-miR-373	CLIP-seq
MIRT1058585	hsa-miR-378g	CLIP-seq
MIRT2013555	hsa-miR-3922-5p	CLIP-seq
MIRT1058586	hsa-miR-4279	CLIP-seq
MIRT2245694	hsa-miR-4284	CLIP-seq
MIRT2013556	hsa-miR-4430	CLIP-seq
MIRT1058587	hsa-miR-4437	CLIP-seq
MIRT2245695	hsa-miR-4438	CLIP-seq
MIRT2245696	hsa-miR-4466	CLIP-seq
MIRT1058589	hsa-miR-4532	CLIP-seq
MIRT1058590	hsa-miR-4674	CLIP-seq
MIRT1058591	hsa-miR-4722-3p	CLIP-seq
MIRT2245697	hsa-miR-4731-5p	CLIP-seq
MIRT2245698	hsa-miR-4772-3p	CLIP-seq
MIRT2245699	hsa-miR-5095	CLIP-seq
MIRT2245700	hsa-miR-512-3p	CLIP-seq
MIRT1058592	hsa-miR-512-5p	CLIP-seq
MIRT2245701	hsa-miR-519d	CLIP-seq
MIRT2245702	hsa-miR-520a-3p	CLIP-seq
MIRT2245703	hsa-miR-520b	CLIP-seq
MIRT2245704	hsa-miR-520c-3p	CLIP-seq
MIRT2245705	hsa-miR-520d-3p	CLIP-seq
MIRT2245706	hsa-miR-520e	CLIP-seq
MIRT2245707	hsa-miR-520g	CLIP-seq
MIRT2245708	hsa-miR-520h	CLIP-seq
MIRT2245709	hsa-miR-552	CLIP-seq
MIRT2013557	hsa-miR-564	CLIP-seq
MIRT2245710	hsa-miR-675	CLIP-seq
MIRT2245711	hsa-miR-764	CLIP-seq
MIRT2245712	hsa-miR-93	CLIP-seq
MIRT2451543	hsa-miR-129-5p	CLIP-seq
MIRT2451544	hsa-miR-153	CLIP-seq
MIRT2451545	hsa-miR-448	CLIP-seq
MIRT2451546	hsa-miR-450b-5p	CLIP-seq
MIRT2451547	hsa-miR-483-5p	CLIP-seq
MIRT2451548	hsa-miR-507	CLIP-seq
MIRT2451549	hsa-miR-557	CLIP-seq
MIRT2451550	hsa-miR-599	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	TAS	8566017
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	6431896
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	6431896
GO:0098609	Process	Cell-cell adhesion	IEA

MIM	HGNC	e!Ensembl
614088	5347	ENSG00000105371

Q14773

Protein name

Intercellular adhesion molecule 4 (ICAM-4) (Landsteiner-Wiener blood group glycoprotein) (LW blood group protein) (CD antigen CD242)

Protein function

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03921	ICAM_N	46 → 136	Intercellular adhesion molecule (ICAM), N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Erythrocytes.

Sequence

MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQ
PGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGK
TRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESL
ERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA
LASGSIAALVGILLTVGAAYLCKCLAMKSQA

Sequence length

271

Interactions

View interactions

Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ICAM4-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Landsteiner-Wiener phenotype	Affects	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (10)
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18322255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	26137540	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28076805, 31083675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15774488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	27616475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27021335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22523428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15774488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16733712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16733712		★★★★★ ★☆☆☆☆ Found in Text Mining only

ICAM4 (intercellular adhesion molecule 4 (Landsteiner-Wiener blood group))

Bookmark This Gene