HYAL4 (hyaluronidase 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23553
Gene name Hyaluronidase 4
Gene symbol HYAL4
Synonyms (NCBI Gene)
CSHYHYAL-4
Chromosome 7
Chromosome location 7q31.32
Summary This gene encodes a protein which is similar in structure to hyaluronidases but lacks hyaluronidase activity. The encoded protein acts as a chondroitin-sulfate-specific endo-beta-N-acetylgalactosaminidase; that is, it exhibits hydrolytic activity toward c
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004415 Function Hyalurononglucosaminidase activity IBA
GO:0004415 Function Hyalurononglucosaminidase activity IEA
GO:0004415 Function Hyalurononglucosaminidase activity TAS 10493834
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005975 Process Carbohydrate metabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604510 5323 ENSG00000106302
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2M3T9
Protein name Hyaluronidase-4 (Hyal-4) (EC 3.2.1.35) (Chondroitin sulfate endo-beta-N-acetylgalactosaminidase) (Chondroitin sulfate hydrolase) (CSHY) (Hyaluronoglucosaminidase-4)
Protein function Endo-hyaluronidase that degrades hyaluronan to smaller oligosaccharide fragments. Also has chondroitin sulfate hydrolase activity, The best substrate being the galactosaminidic linkage in the sequence of a trisulfated tetrasaccharide. {ECO:00002
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01630 Glyco_hydro_56 41 → 373 Hyaluronidase Domain
Tissue specificity TISSUE SPECIFICITY: Detected in placenta and skeletal muscle. {ECO:0000269|PubMed:10493834}.
Sequence 
MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYSGSCPED
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQ
L
Sequence length 481
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Sort by:
SPAM1 2 shared pathwaysGlycosaminoglycan degradation, Lysosome Related via 2 shared pathways including Glycosaminoglycan degradation, Lysosome. HYAL2 2 shared pathwaysGlycosaminoglycan degradation, Lysosome Related via 2 shared pathways including Glycosaminoglycan degradation, Lysosome. HGSNAT 2 shared pathwaysGlycosaminoglycan degradation, Lysosome Related via 2 shared pathways including Glycosaminoglycan degradation, Lysosome. GALNS 2 shared pathwaysGlycosaminoglycan degradation, Lysosome Related via 2 shared pathways including Glycosaminoglycan degradation, Lysosome. NAGLU 2 shared pathwaysGlycosaminoglycan degradation, Lysosome Related via 2 shared pathways including Glycosaminoglycan degradation, Lysosome.
Desbuquois syndrome Linked via 3 of 5 related genesHGSNAT, GALNS, NAGLU Mucopolysaccharidosis Linked via 3 of 5 related genesHGSNAT, GALNS, NAGLU Schizophrenia Linked via 2 of 5 related genesHYAL2, NAGLU Intellectual developmental disorder Linked via 2 of 5 related genesHGSNAT, NAGLU Sanfilippo syndrome Linked via 2 of 5 related genesHGSNAT, NAGLU