HS3ST3B1 (heparan sulfate-glucosamine 3-sulfotransferase 3B1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9953
• Gene name: Heparan sulfate-glucosamine 3-sulfotransferase 3B1
• Gene symbol: HS3ST3B1
• Synonyms (NCBI Gene): 3-OST-3B, 3OST3B1, h3-OST-3B
• Chromosome: 17
• Chromosome location: 17p12
• Summary: The protein encoded by this gene is a type II integral membrane protein that belongs to the 3-O-sulfotransferases family. These proteins catalyze the addition of sulfate groups at the 3-OH position of glucosamine in heparan sulfate. The substrate specific

miRNA Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026649	hsa-miR-192-5p	Microarray	19074876
MIRT030947	hsa-miR-21-5p	Sequencing	20371350
MIRT657278	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657277	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT657276	hsa-miR-548ax	HITS-CLIP	23824327
MIRT657274	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT657275	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT657273	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657272	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT657271	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT506948	hsa-miR-132-3p	PAR-CLIP	22012620
MIRT506947	hsa-miR-212-3p	PAR-CLIP	22012620
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	22012620
MIRT506945	hsa-miR-4477a	PAR-CLIP	22012620
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	27292025
MIRT506947	hsa-miR-212-3p	PAR-CLIP	27292025
MIRT506945	hsa-miR-4477a	PAR-CLIP	27292025
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	27292025
MIRT657278	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657277	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT657276	hsa-miR-548ax	HITS-CLIP	23824327
MIRT657274	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT657275	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT657273	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657272	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT657271	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT506948	hsa-miR-132-3p	PAR-CLIP	22012620
MIRT506947	hsa-miR-212-3p	PAR-CLIP	22012620
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	22012620
MIRT506945	hsa-miR-4477a	PAR-CLIP	22012620
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054939	hsa-miR-146a	CLIP-seq
MIRT1054940	hsa-miR-146b-5p	CLIP-seq
MIRT1054941	hsa-miR-1827	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054943	hsa-miR-216a	CLIP-seq
MIRT1054944	hsa-miR-216b	CLIP-seq
MIRT1054945	hsa-miR-3173-3p	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054947	hsa-miR-3612	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT1054949	hsa-miR-3686	CLIP-seq
MIRT1054950	hsa-miR-4434	CLIP-seq
MIRT1054951	hsa-miR-4516	CLIP-seq
MIRT1054952	hsa-miR-4531	CLIP-seq
MIRT1054953	hsa-miR-4652-3p	CLIP-seq
MIRT1054954	hsa-miR-4695-5p	CLIP-seq
MIRT1054955	hsa-miR-577	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054957	hsa-miR-650	CLIP-seq
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054941	hsa-miR-1827	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054945	hsa-miR-3173-3p	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054947	hsa-miR-3612	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT2244830	hsa-miR-4514	CLIP-seq
MIRT2244831	hsa-miR-4692	CLIP-seq
MIRT1054954	hsa-miR-4695-5p	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054957	hsa-miR-650	CLIP-seq
MIRT2244832	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9988767
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IDA	9988768
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IBA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IDA	9988768
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IEA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	TAS	9988767
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IEA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	TAS	9988767, 9988768
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA

Other IDs

• MIM: 604058
• HGNC: 5198
• e!Ensembl: ENSG00000125430

Protein

• UniProt ID: Q9Y662
• Protein name: Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 (EC 2.8.2.30) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1) (3-OST-3B) (Heparan sulfate 3-O-sulfotransferase 3B1) (h3-OST-3B)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate (PubMed:10520990, PubMed:9988768). Catal
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	137 → 384	Sulfotransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Most abundant in liver and placenta, followed by heart and kidney. {ECO:0000269|PubMed:9988767}.
• Sequence:

  MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPG
  LLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPD
  SPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
  LAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQ
  TLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
  ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
  DREVVRRLREFYRPFNLKFYQMTGHDFGWD

• Sequence length: 390

Pathways

KEGG Pathway:

Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Reactome Pathway:

HS-GAG biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CHRONIC KIDNEY DISEASE	—	GWAS catalog	31178898	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	20864642	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL CORNEAL DYSTROPHY	—	GWAS catalog	38582945	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS' ENDOTHELIAL DYSTROPHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	23291589, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	37094658	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30984249		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30360368		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12819009	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30984249		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	20705311	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36246561	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25536282		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30360368		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21709440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30984249		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29516954		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21709440		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21709440	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NDST3 1 shared diseaseKeratoconus 2 shared pathwaysGlycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis 2 shared evidence sourcesGWAS catalog (Kidney disease), GWAS catalog (Keratoconus) Related via 2 shared pathways including Glycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis — evidence mostly GWAS catalog. RPLP2 2 shared diseasesFuchs endothelial dystrophy, Keratoconus 2 shared evidence sourcesGWAS catalog (Fuchs endothelial dystrophy), GWAS catalog (Keratoconus) Related via 2 shared diseases including Fuchs endothelial dystrophy, Keratoconus — evidence mostly GWAS catalog. HS3ST5 2 shared pathwaysGlycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis Related via 2 shared pathways including Glycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis. HS6ST3 2 shared pathwaysGlycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis Related via 2 shared pathways including Glycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis. NDST1 2 shared pathwaysGlycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis Related via 2 shared pathways including Glycosaminoglycan biosynthesis - heparan sulfate / heparin, HS-GAG biosynthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NDST3	1	["Keratoconus"]	2	["Glycosaminoglycan biosynthesis - heparan sulfate \/ heparin","HS-GAG biosynthesis"]	2	["GWAS catalog (Kidney disease)","GWAS catalog (Keratoconus)"]
RPLP2	2	["Fuchs endothelial dystrophy","Keratoconus"]	0	[]	2	["GWAS catalog (Fuchs endothelial dystrophy)","GWAS catalog (Keratoconus)"]
HS3ST5	0	[]	2	["Glycosaminoglycan biosynthesis - heparan sulfate \/ heparin","HS-GAG biosynthesis"]	0	[]
HS6ST3	0	[]	2	["Glycosaminoglycan biosynthesis - heparan sulfate \/ heparin","HS-GAG biosynthesis"]	0	[]
NDST1	0	[]	2	["Glycosaminoglycan biosynthesis - heparan sulfate \/ heparin","HS-GAG biosynthesis"]	0	[]

Diseases Linked via Similar Genes

Schizophrenia Linked via 3 of 5 related genesNDST3, HS3ST5, HS6ST3 Metabolic syndrome Linked via 2 of 5 related genesNDST3, HS6ST3 Diabetes mellitus type 2 Linked via 2 of 5 related genesNDST3, HS6ST3 Breast cancer Linked via 2 of 5 related genesRPLP2, HS6ST3 Bipolar disorder Linked via 1 of 5 related genesNDST3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	3	["NDST3","HS3ST5","HS6ST3"]
Metabolic syndrome	2	["NDST3","HS6ST3"]
Diabetes mellitus type 2	2	["NDST3","HS6ST3"]
Breast cancer	2	["RPLP2","HS6ST3"]
Bipolar disorder	1	["NDST3"]