Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3174
Gene name	Hepatocyte nuclear factor 4 gamma
Gene symbol	HNF4G
Synonyms (NCBI Gene)	NR2A2NR2A3
Chromosome	8
Chromosome location	8q21.13

56 Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT709336	hsa-miR-4799-5p	HITS-CLIP	19536157
MIRT709335	hsa-miR-4263	HITS-CLIP	19536157
MIRT709334	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT709333	hsa-miR-3149	HITS-CLIP	19536157
MIRT709332	hsa-miR-129-5p	HITS-CLIP	19536157
MIRT709336	hsa-miR-4799-5p	HITS-CLIP	19536157
MIRT709335	hsa-miR-4263	HITS-CLIP	19536157
MIRT709334	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT709333	hsa-miR-3149	HITS-CLIP	19536157
MIRT709332	hsa-miR-129-5p	HITS-CLIP	19536157
MIRT1050583	hsa-miR-101	CLIP-seq
MIRT1050584	hsa-miR-1197	CLIP-seq
MIRT1050585	hsa-miR-139-5p	CLIP-seq
MIRT1050586	hsa-miR-140-5p	CLIP-seq
MIRT1050587	hsa-miR-144	CLIP-seq
MIRT1050588	hsa-miR-3121-3p	CLIP-seq
MIRT1050589	hsa-miR-3646	CLIP-seq
MIRT1050590	hsa-miR-3924	CLIP-seq
MIRT1050591	hsa-miR-410	CLIP-seq
MIRT1050592	hsa-miR-4272	CLIP-seq
MIRT1050593	hsa-miR-4738-3p	CLIP-seq
MIRT1050594	hsa-miR-4796-3p	CLIP-seq
MIRT1050595	hsa-miR-485-3p	CLIP-seq
MIRT1050596	hsa-miR-498	CLIP-seq
MIRT1050597	hsa-miR-513a-3p	CLIP-seq
MIRT1050598	hsa-miR-548v	CLIP-seq
MIRT1050599	hsa-miR-568	CLIP-seq
MIRT1920479	hsa-miR-3120-3p	CLIP-seq
MIRT1920480	hsa-miR-596	CLIP-seq
MIRT1920479	hsa-miR-3120-3p	CLIP-seq
MIRT1920480	hsa-miR-596	CLIP-seq
MIRT1920479	hsa-miR-3120-3p	CLIP-seq
MIRT1920480	hsa-miR-596	CLIP-seq
MIRT2243779	hsa-miR-1224-3p	CLIP-seq
MIRT2243780	hsa-miR-1260	CLIP-seq
MIRT2243781	hsa-miR-1260b	CLIP-seq
MIRT2243782	hsa-miR-1269	CLIP-seq
MIRT2243783	hsa-miR-1269b	CLIP-seq
MIRT2243784	hsa-miR-128	CLIP-seq
MIRT2243785	hsa-miR-1280	CLIP-seq
MIRT2243786	hsa-miR-188-3p	CLIP-seq
MIRT2243787	hsa-miR-188-5p	CLIP-seq
MIRT2243788	hsa-miR-27a	CLIP-seq
MIRT2243789	hsa-miR-27b	CLIP-seq
MIRT2243790	hsa-miR-3156-3p	CLIP-seq
MIRT2243791	hsa-miR-4279	CLIP-seq
MIRT2243792	hsa-miR-432	CLIP-seq
MIRT2243793	hsa-miR-4446-5p	CLIP-seq
MIRT2243794	hsa-miR-4529-3p	CLIP-seq
MIRT2243795	hsa-miR-4755-5p	CLIP-seq
MIRT2243796	hsa-miR-617	CLIP-seq
MIRT2243797	hsa-miR-642a	CLIP-seq
MIRT2389077	hsa-miR-1208	CLIP-seq
MIRT2389078	hsa-miR-2909	CLIP-seq
MIRT2389079	hsa-miR-452	CLIP-seq
MIRT2389080	hsa-miR-4676-3p	CLIP-seq

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12220531
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	23896584
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8622695
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8622695
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23896584
GO:0046872	Function	Metal ion binding	IEA
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
605966	5026	ENSG00000164749

Q14541

Protein name

Hepatocyte nuclear factor 4-gamma (HNF-4-gamma) (Nuclear receptor subfamily 2 group A member 2)

Protein function

Transcription factor. Has a lower transcription activation potential than HNF4-alpha.

PDB

1LV2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00104	Hormone_recep	124 → 312	Ligand-binding domain of nuclear hormone receptor	Domain
PF00105	zf-C4	10 → 79	Zinc finger, C4 type (two domains)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.

Sequence

MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDK
RNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVS
SPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHL
LLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACL
KAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMS
TLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

Sequence length

408

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Maturity onset diabetes of the young	Nuclear Receptor transcription pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (32)
ALZHEIMER DISEASE	—	GWAS catalog	26830138, 30514930	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	25918132	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	23535729, 25751625, 29059683, 32139696, 32887889, 36819030, 37380357	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	23535729, 25751625, 29058716, 29059683, 32139696, 32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	29531354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	29531354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	29058716, 32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	37380357	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	23263486, 31578528, 31985003, 33356394, 33462484, 39024449, 39406924, 40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	37947095, 38965376, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	40835619	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	38858783	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23563607	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889, 36819030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	29422604	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256, 39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (30)
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25878394, 29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20976847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25878394, 29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30896821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29907492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30896821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	22523087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10990086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10990086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	28252667	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	Pubtator	28460474	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	28460474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal disease	Pubtator	25800782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26854454, 29422604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25878394, 29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29719587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23563607, 29976977	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39341888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26854454, 29422604		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	29422604		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26854454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29907492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17262812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25878394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HNF4G (hepatocyte nuclear factor 4 gamma)

Bookmark This Gene