Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	93323
Gene name	HAUS augmin like complex subunit 8
Gene symbol	HAUS8
Synonyms (NCBI Gene)	DGT4HICE1NY-SAR-48
Chromosome	19
Chromosome location	19p13.11
Summary	HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb `augmentare,` meaning `to increase.` The augmin complex is a microtubule-binding co

138 Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016543	hsa-miR-193b-3p	Microarray	20304954
MIRT027964	hsa-miR-93-5p	Sequencing	20371350
MIRT028948	hsa-miR-26b-5p	Sequencing	20371350
MIRT046686	hsa-miR-222-3p	CLASH	23622248
MIRT574738	hsa-miR-302e	PAR-CLIP	20371350
MIRT574736	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT574737	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT574735	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT574734	hsa-miR-520b	PAR-CLIP	20371350
MIRT574733	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT574732	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT574731	hsa-miR-520e	PAR-CLIP	20371350
MIRT574730	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT574729	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT574728	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574727	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT440508	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT574726	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT574725	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT574724	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT440509	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT574723	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT574722	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT027964	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT574721	hsa-miR-3609	PAR-CLIP	20371350
MIRT574720	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT574719	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT574718	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT574717	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT574716	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT574715	hsa-miR-5697	PAR-CLIP	20371350
MIRT574713	hsa-miR-7158-5p	PAR-CLIP	20371350
MIRT574714	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT574712	hsa-miR-1297	PAR-CLIP	20371350
MIRT574711	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT028948	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT574710	hsa-miR-4465	PAR-CLIP	20371350
MIRT440508	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440509	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440508	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT574723	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT574724	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT027964	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT574725	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440509	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT574711	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT028948	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT574738	hsa-miR-302e	PAR-CLIP	20371350
MIRT574736	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT574737	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT574735	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT574734	hsa-miR-520b	PAR-CLIP	20371350
MIRT574733	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT574732	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT574731	hsa-miR-520e	PAR-CLIP	20371350
MIRT574730	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT574729	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT574728	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574727	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT440508	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT574726	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT574725	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT574724	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT440509	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT574723	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT574722	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT027964	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT574721	hsa-miR-3609	PAR-CLIP	20371350
MIRT574720	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT574719	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT574718	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT574717	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT574716	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT574715	hsa-miR-5697	PAR-CLIP	20371350
MIRT574713	hsa-miR-7158-5p	PAR-CLIP	20371350
MIRT574714	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT574712	hsa-miR-1297	PAR-CLIP	20371350
MIRT574711	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT028948	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT574710	hsa-miR-4465	PAR-CLIP	20371350
MIRT1041387	hsa-miR-106a	CLIP-seq
MIRT1041388	hsa-miR-106b	CLIP-seq
MIRT1041389	hsa-miR-139-5p	CLIP-seq
MIRT1041390	hsa-miR-17	CLIP-seq
MIRT1041391	hsa-miR-20a	CLIP-seq
MIRT1041392	hsa-miR-20b	CLIP-seq
MIRT1041393	hsa-miR-26a	CLIP-seq
MIRT1041394	hsa-miR-26b	CLIP-seq
MIRT1041395	hsa-miR-302a	CLIP-seq
MIRT1041396	hsa-miR-302b	CLIP-seq
MIRT1041397	hsa-miR-302c	CLIP-seq
MIRT1041398	hsa-miR-302d	CLIP-seq
MIRT1041399	hsa-miR-3140-5p	CLIP-seq
MIRT1041400	hsa-miR-340	CLIP-seq
MIRT1041401	hsa-miR-372	CLIP-seq
MIRT1041402	hsa-miR-373	CLIP-seq
MIRT1041403	hsa-miR-410	CLIP-seq
MIRT1041404	hsa-miR-519d	CLIP-seq
MIRT1041405	hsa-miR-548ah	CLIP-seq
MIRT1041406	hsa-miR-548v	CLIP-seq
MIRT1041407	hsa-miR-93	CLIP-seq
MIRT1041387	hsa-miR-106a	CLIP-seq
MIRT1041388	hsa-miR-106b	CLIP-seq
MIRT1041390	hsa-miR-17	CLIP-seq
MIRT1041391	hsa-miR-20a	CLIP-seq
MIRT1041392	hsa-miR-20b	CLIP-seq
MIRT1041393	hsa-miR-26a	CLIP-seq
MIRT1041394	hsa-miR-26b	CLIP-seq
MIRT1041395	hsa-miR-302a	CLIP-seq
MIRT1041396	hsa-miR-302b	CLIP-seq
MIRT1041397	hsa-miR-302c	CLIP-seq
MIRT1041398	hsa-miR-302d	CLIP-seq
MIRT1041400	hsa-miR-340	CLIP-seq
MIRT1041401	hsa-miR-372	CLIP-seq
MIRT1041402	hsa-miR-373	CLIP-seq
MIRT1041403	hsa-miR-410	CLIP-seq
MIRT1041404	hsa-miR-519d	CLIP-seq
MIRT1041405	hsa-miR-548ah	CLIP-seq
MIRT1041407	hsa-miR-93	CLIP-seq
MIRT1041387	hsa-miR-106a	CLIP-seq
MIRT1041388	hsa-miR-106b	CLIP-seq
MIRT1041390	hsa-miR-17	CLIP-seq
MIRT1041391	hsa-miR-20a	CLIP-seq
MIRT1041392	hsa-miR-20b	CLIP-seq
MIRT1041393	hsa-miR-26a	CLIP-seq
MIRT1041394	hsa-miR-26b	CLIP-seq
MIRT1041395	hsa-miR-302a	CLIP-seq
MIRT1041396	hsa-miR-302b	CLIP-seq
MIRT1041397	hsa-miR-302c	CLIP-seq
MIRT1041398	hsa-miR-302d	CLIP-seq
MIRT1041399	hsa-miR-3140-5p	CLIP-seq
MIRT1041400	hsa-miR-340	CLIP-seq
MIRT1041401	hsa-miR-372	CLIP-seq
MIRT1041402	hsa-miR-373	CLIP-seq
MIRT1041403	hsa-miR-410	CLIP-seq
MIRT1041404	hsa-miR-519d	CLIP-seq
MIRT1041405	hsa-miR-548ah	CLIP-seq
MIRT1041407	hsa-miR-93	CLIP-seq

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	19369198, 20360068, 24981860, 25173975, 30723163, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005880	Component	Nuclear microtubule	IBA
GO:0007098	Process	Centrosome cycle	IBA
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0007098	Process	Centrosome cycle	NAS	20360068
GO:0008017	Function	Microtubule binding	IBA
GO:0010968	Process	Regulation of microtubule nucleation	NAS	30044976
GO:0051225	Process	Spindle assembly	IBA
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051225	Process	Spindle assembly	NAS	20360068
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0070652	Component	HAUS complex	IPI	20360068
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

MIM	HGNC	e!Ensembl
613434	30532	ENSG00000131351

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BT25
Protein name	HAUS augmin-like complex subunit 8 (HEC1/NDC80-interacting centrosome-associated protein 1) (Sarcoma antigen NY-SAR-48)
Protein function	Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
PDB	7SQK
Family and domains
Sequence	MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRG KMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLA KTISKKPESTSFSAPRKKSPDLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLI MCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATAL DTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDV TAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGA PKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS
Sequence length	410
Interactions	View interactions

Reactome Pathway
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	36187959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	41238958	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	27723758	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aneuploidy	Aneuploidy	Pubtator	18362163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26061684, 35954157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26061684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	18362163		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SDCCAG8	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP250	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
HAUS1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
NEDD1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP164	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]

HAUS8 (HAUS augmin like complex subunit 8)

Save This Analysis