Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54801
Gene name	HAUS augmin like complex subunit 6
Gene symbol	HAUS6
Synonyms (NCBI Gene)	Dgt6FAM29A
Chromosome	9
Chromosome location	9p22.1
Summary	The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. This protein may have a role in efficient chromosome congression and segregati

225 Show/Hide all (225)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022559	hsa-miR-124-3p	Microarray	18668037
MIRT052232	hsa-let-7b-5p	CLASH	23622248
MIRT048214	hsa-miR-196a-5p	CLASH	23622248
MIRT044486	hsa-miR-320a	CLASH	23622248
MIRT441730	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT441729	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT441728	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT441727	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT441726	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT441725	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT441724	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT441722	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT441723	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT441721	hsa-miR-4773	PAR-CLIP	22100165
MIRT441730	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT441729	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT441728	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT441727	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT441726	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT441725	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT441724	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT441722	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT441723	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT441721	hsa-miR-4773	PAR-CLIP	22100165
MIRT1041267	hsa-miR-1184	CLIP-seq
MIRT1041268	hsa-miR-1205	CLIP-seq
MIRT1041269	hsa-miR-125a-5p	CLIP-seq
MIRT1041270	hsa-miR-125b	CLIP-seq
MIRT1041271	hsa-miR-1262	CLIP-seq
MIRT1041272	hsa-miR-1271	CLIP-seq
MIRT1041273	hsa-miR-1273e	CLIP-seq
MIRT1041274	hsa-miR-1275	CLIP-seq
MIRT1041275	hsa-miR-1283	CLIP-seq
MIRT1041276	hsa-miR-1293	CLIP-seq
MIRT1041277	hsa-miR-129-3p	CLIP-seq
MIRT1041278	hsa-miR-1323	CLIP-seq
MIRT1041279	hsa-miR-144	CLIP-seq
MIRT1041280	hsa-miR-182	CLIP-seq
MIRT1041281	hsa-miR-186	CLIP-seq
MIRT1041282	hsa-miR-1914	CLIP-seq
MIRT1041283	hsa-miR-193a-3p	CLIP-seq
MIRT1041284	hsa-miR-193b	CLIP-seq
MIRT1041285	hsa-miR-2054	CLIP-seq
MIRT1041286	hsa-miR-2114	CLIP-seq
MIRT1041287	hsa-miR-216a	CLIP-seq
MIRT1041288	hsa-miR-23a	CLIP-seq
MIRT1041289	hsa-miR-23b	CLIP-seq
MIRT1041290	hsa-miR-23c	CLIP-seq
MIRT1041291	hsa-miR-302a	CLIP-seq
MIRT1041292	hsa-miR-302b	CLIP-seq
MIRT1041293	hsa-miR-302c	CLIP-seq
MIRT1041294	hsa-miR-302d	CLIP-seq
MIRT1041295	hsa-miR-302e	CLIP-seq
MIRT1041296	hsa-miR-3065-5p	CLIP-seq
MIRT1041297	hsa-miR-3124-3p	CLIP-seq
MIRT1041298	hsa-miR-3133	CLIP-seq
MIRT1041299	hsa-miR-3144-3p	CLIP-seq
MIRT1041300	hsa-miR-3156-5p	CLIP-seq
MIRT1041301	hsa-miR-3158-5p	CLIP-seq
MIRT1041302	hsa-miR-3161	CLIP-seq
MIRT1041303	hsa-miR-3185	CLIP-seq
MIRT1041304	hsa-miR-3199	CLIP-seq
MIRT1041305	hsa-miR-3200-5p	CLIP-seq
MIRT1041306	hsa-miR-335	CLIP-seq
MIRT1041307	hsa-miR-3617	CLIP-seq
MIRT1041308	hsa-miR-3688-5p	CLIP-seq
MIRT1041309	hsa-miR-372	CLIP-seq
MIRT1041310	hsa-miR-373	CLIP-seq
MIRT1041311	hsa-miR-376a	CLIP-seq
MIRT1041312	hsa-miR-376b	CLIP-seq
MIRT1041313	hsa-miR-382	CLIP-seq
MIRT1041314	hsa-miR-3910	CLIP-seq
MIRT1041315	hsa-miR-3926	CLIP-seq
MIRT1041316	hsa-miR-3942-3p	CLIP-seq
MIRT1041317	hsa-miR-4251	CLIP-seq
MIRT1041318	hsa-miR-4255	CLIP-seq
MIRT1041319	hsa-miR-4319	CLIP-seq
MIRT1041320	hsa-miR-4320	CLIP-seq
MIRT1041321	hsa-miR-4326	CLIP-seq
MIRT1041322	hsa-miR-4329	CLIP-seq
MIRT1041323	hsa-miR-4330	CLIP-seq
MIRT1041324	hsa-miR-4436b-5p	CLIP-seq
MIRT1041325	hsa-miR-4450	CLIP-seq
MIRT1041326	hsa-miR-4477a	CLIP-seq
MIRT1041327	hsa-miR-4483	CLIP-seq
MIRT1041328	hsa-miR-4494	CLIP-seq
MIRT1041329	hsa-miR-4502	CLIP-seq
MIRT1041330	hsa-miR-4515	CLIP-seq
MIRT1041331	hsa-miR-4525	CLIP-seq
MIRT1041332	hsa-miR-4639-5p	CLIP-seq
MIRT1041333	hsa-miR-4645-3p	CLIP-seq
MIRT1041334	hsa-miR-4665-5p	CLIP-seq
MIRT1041335	hsa-miR-4687-5p	CLIP-seq
MIRT1041336	hsa-miR-4701-3p	CLIP-seq
MIRT1041337	hsa-miR-4711-5p	CLIP-seq
MIRT1041338	hsa-miR-4717-3p	CLIP-seq
MIRT1041339	hsa-miR-4720-5p	CLIP-seq
MIRT1041340	hsa-miR-4723-5p	CLIP-seq
MIRT1041341	hsa-miR-4728-3p	CLIP-seq
MIRT1041342	hsa-miR-4729	CLIP-seq
MIRT1041343	hsa-miR-4732-3p	CLIP-seq
MIRT1041344	hsa-miR-4760-3p	CLIP-seq
MIRT1041345	hsa-miR-4762-3p	CLIP-seq
MIRT1041346	hsa-miR-4799-3p	CLIP-seq
MIRT1041347	hsa-miR-499a-5p	CLIP-seq
MIRT1041348	hsa-miR-502-5p	CLIP-seq
MIRT1041349	hsa-miR-513a-3p	CLIP-seq
MIRT1041350	hsa-miR-513a-5p	CLIP-seq
MIRT1041351	hsa-miR-514	CLIP-seq
MIRT1041352	hsa-miR-514b-3p	CLIP-seq
MIRT1041353	hsa-miR-519a	CLIP-seq
MIRT1041354	hsa-miR-519b-3p	CLIP-seq
MIRT1041355	hsa-miR-519c-3p	CLIP-seq
MIRT1041356	hsa-miR-520a-3p	CLIP-seq
MIRT1041357	hsa-miR-520b	CLIP-seq
MIRT1041358	hsa-miR-520c-3p	CLIP-seq
MIRT1041359	hsa-miR-520d-3p	CLIP-seq
MIRT1041360	hsa-miR-520d-5p	CLIP-seq
MIRT1041361	hsa-miR-520e	CLIP-seq
MIRT1041362	hsa-miR-524-5p	CLIP-seq
MIRT1041363	hsa-miR-544	CLIP-seq
MIRT1041364	hsa-miR-548an	CLIP-seq
MIRT1041365	hsa-miR-548c-3p	CLIP-seq
MIRT1041366	hsa-miR-548o	CLIP-seq
MIRT1041367	hsa-miR-548s	CLIP-seq
MIRT1041368	hsa-miR-579	CLIP-seq
MIRT1041369	hsa-miR-584	CLIP-seq
MIRT1041370	hsa-miR-590-3p	CLIP-seq
MIRT1041371	hsa-miR-617	CLIP-seq
MIRT1041372	hsa-miR-625	CLIP-seq
MIRT1041373	hsa-miR-637	CLIP-seq
MIRT1041374	hsa-miR-641	CLIP-seq
MIRT1041375	hsa-miR-656	CLIP-seq
MIRT1041376	hsa-miR-664	CLIP-seq
MIRT1041377	hsa-miR-670	CLIP-seq
MIRT1041378	hsa-miR-875-5p	CLIP-seq
MIRT1041379	hsa-miR-892b	CLIP-seq
MIRT1041380	hsa-miR-96	CLIP-seq
MIRT1041271	hsa-miR-1262	CLIP-seq
MIRT1041276	hsa-miR-1293	CLIP-seq
MIRT1041281	hsa-miR-186	CLIP-seq
MIRT2008648	hsa-miR-218	CLIP-seq
MIRT2008649	hsa-miR-297	CLIP-seq
MIRT1041298	hsa-miR-3133	CLIP-seq
MIRT2008650	hsa-miR-3160-5p	CLIP-seq
MIRT2008651	hsa-miR-3163	CLIP-seq
MIRT2008652	hsa-miR-3201	CLIP-seq
MIRT2008653	hsa-miR-361-5p	CLIP-seq
MIRT2008654	hsa-miR-3622a-5p	CLIP-seq
MIRT2008655	hsa-miR-3925-3p	CLIP-seq
MIRT1041315	hsa-miR-3926	CLIP-seq
MIRT2008656	hsa-miR-3941	CLIP-seq
MIRT1041318	hsa-miR-4255	CLIP-seq
MIRT1041321	hsa-miR-4326	CLIP-seq
MIRT2008657	hsa-miR-4328	CLIP-seq
MIRT2008658	hsa-miR-4423-3p	CLIP-seq
MIRT2008659	hsa-miR-4471	CLIP-seq
MIRT1041327	hsa-miR-4483	CLIP-seq
MIRT1041333	hsa-miR-4645-3p	CLIP-seq
MIRT2008660	hsa-miR-466	CLIP-seq
MIRT2008661	hsa-miR-4666-5p	CLIP-seq
MIRT2008662	hsa-miR-4672	CLIP-seq
MIRT1041336	hsa-miR-4701-3p	CLIP-seq
MIRT1041338	hsa-miR-4717-3p	CLIP-seq
MIRT2008663	hsa-miR-4791	CLIP-seq
MIRT2008664	hsa-miR-4797-3p	CLIP-seq
MIRT2008665	hsa-miR-4802-3p	CLIP-seq
MIRT2008666	hsa-miR-490-5p	CLIP-seq
MIRT1041347	hsa-miR-499a-5p	CLIP-seq
MIRT1041348	hsa-miR-502-5p	CLIP-seq
MIRT2008667	hsa-miR-5095	CLIP-seq
MIRT1041351	hsa-miR-514	CLIP-seq
MIRT1041352	hsa-miR-514b-3p	CLIP-seq
MIRT1041367	hsa-miR-548s	CLIP-seq
MIRT2008668	hsa-miR-567	CLIP-seq
MIRT1041370	hsa-miR-590-3p	CLIP-seq
MIRT2008669	hsa-miR-636	CLIP-seq
MIRT2008670	hsa-miR-766	CLIP-seq
MIRT2008671	hsa-miR-921	CLIP-seq
MIRT2241104	hsa-miR-1252	CLIP-seq
MIRT2241105	hsa-miR-1827	CLIP-seq
MIRT1041296	hsa-miR-3065-5p	CLIP-seq
MIRT2241106	hsa-miR-3923	CLIP-seq
MIRT2008655	hsa-miR-3925-3p	CLIP-seq
MIRT1041318	hsa-miR-4255	CLIP-seq
MIRT2241107	hsa-miR-4316	CLIP-seq
MIRT1041321	hsa-miR-4326	CLIP-seq
MIRT2241108	hsa-miR-4536	CLIP-seq
MIRT1041333	hsa-miR-4645-3p	CLIP-seq
MIRT2241109	hsa-miR-4722-5p	CLIP-seq
MIRT2241110	hsa-miR-4768-3p	CLIP-seq
MIRT1041348	hsa-miR-502-5p	CLIP-seq
MIRT1041351	hsa-miR-514	CLIP-seq
MIRT1041352	hsa-miR-514b-3p	CLIP-seq
MIRT2008670	hsa-miR-766	CLIP-seq
MIRT2241111	hsa-miR-940	CLIP-seq
MIRT2450973	hsa-miR-22	CLIP-seq
MIRT2450974	hsa-miR-320b	CLIP-seq
MIRT2450975	hsa-miR-320c	CLIP-seq
MIRT2450976	hsa-miR-320d	CLIP-seq
MIRT2450977	hsa-miR-3929	CLIP-seq
MIRT2450978	hsa-miR-4419b	CLIP-seq
MIRT2450979	hsa-miR-4429	CLIP-seq
MIRT2450980	hsa-miR-4478	CLIP-seq
MIRT2450981	hsa-miR-4493	CLIP-seq
MIRT2450982	hsa-miR-4769-3p	CLIP-seq
MIRT2544643	hsa-miR-1257	CLIP-seq
MIRT2008649	hsa-miR-297	CLIP-seq
MIRT2544644	hsa-miR-3170	CLIP-seq
MIRT2544645	hsa-miR-3189-3p	CLIP-seq
MIRT2544646	hsa-miR-3924	CLIP-seq
MIRT2544647	hsa-miR-4643	CLIP-seq
MIRT1041338	hsa-miR-4717-3p	CLIP-seq
MIRT2008668	hsa-miR-567	CLIP-seq
MIRT2544648	hsa-miR-642b	CLIP-seq
MIRT2544643	hsa-miR-1257	CLIP-seq
MIRT2682226	hsa-miR-150	CLIP-seq
MIRT2008649	hsa-miR-297	CLIP-seq
MIRT2544644	hsa-miR-3170	CLIP-seq
MIRT2544645	hsa-miR-3189-3p	CLIP-seq
MIRT2544646	hsa-miR-3924	CLIP-seq
MIRT2544647	hsa-miR-4643	CLIP-seq
MIRT1041338	hsa-miR-4717-3p	CLIP-seq
MIRT2008668	hsa-miR-567	CLIP-seq
MIRT2544648	hsa-miR-642b	CLIP-seq

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005515	Function	Protein binding	IPI	19369198, 20360068, 24981860, 25173975, 26496610, 30723163, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0007098	Process	Centrosome cycle	NAS	20360068
GO:0008017	Function	Microtubule binding	IBA
GO:0010968	Process	Regulation of microtubule nucleation	NAS	30044976
GO:0051225	Process	Spindle assembly	IEA
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051225	Process	Spindle assembly	NAS	20360068
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0070652	Component	HAUS complex	IEA
GO:0070652	Component	HAUS complex	IPI	20360068
GO:1990498	Component	Mitotic spindle microtubule	IBA
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

MIM	HGNC	e!Ensembl
613433	25948	ENSG00000147874

Q7Z4H7

Protein name

HAUS augmin-like complex subunit 6

Protein function

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-t

PDB

7SQK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14661	HAUS6_N	14 → 239	HAUS augmin-like complex subunit 6 N-terminus	Family

Sequence

MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYF
LFQVLDQSLTKEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPG
GPKFIHLMYHFARFVAMKYIKSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQIL
QRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWAS
VNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLLLDKIEKQMFQLHIGNVYEAG
KLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSDLKHMRYRIKD
DLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAK
SILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLE
KDTKMGTPKEKNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHL
VEEVARAVLSDSPQLSEGKEIKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAI
EMEENRTKEPIQMDAEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVIS
DCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGN
RIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETL
PEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEAL
KKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSI
GERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR

Sequence length

955

Interactions

View interactions

Reactome Pathway
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
BASAL CELL CARCINOMA	—	GWAS catalog	31174203, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	38062574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	31174203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	31043753	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	29892016, 33398198, 37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	29892016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	29892016, 33290408, 33398198, 37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969, 32541925, 33290408, 35551307, 38062574, 38374256, 38685053, 39379762	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	31174203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32526247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33290408, 37540242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31043753	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33290408, 35741800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SDCCAG8	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP250	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
HAUS1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
NEDD1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP164	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]

HAUS6 (HAUS augmin like complex subunit 6)

Bookmark This Gene